Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   J7W01_RS12185 Genome accession   NZ_CP072525
Coordinates   2401164..2401547 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain YB-04     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2396164..2406547
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J7W01_RS12145 (J7W01_12145) sinI 2397098..2397271 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  J7W01_RS12150 (J7W01_12150) sinR 2397305..2397640 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  J7W01_RS12155 (J7W01_12155) tasA 2397733..2398518 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  J7W01_RS12160 (J7W01_12160) sipW 2398582..2399154 (-) 573 WP_003246088.1 signal peptidase I SipW -
  J7W01_RS12165 (J7W01_12165) tapA 2399138..2399899 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  J7W01_RS12170 (J7W01_12170) yqzG 2400171..2400497 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  J7W01_RS12175 (J7W01_12175) spoIITA 2400539..2400718 (-) 180 WP_003230176.1 YqzE family protein -
  J7W01_RS12180 (J7W01_12180) comGG 2400789..2401163 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  J7W01_RS12185 (J7W01_12185) comGF 2401164..2401547 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  J7W01_RS12190 (J7W01_12190) comGE 2401573..2401920 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  J7W01_RS12195 (J7W01_12195) comGD 2401904..2402335 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  J7W01_RS12200 (J7W01_12200) comGC 2402325..2402621 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  J7W01_RS12205 (J7W01_12205) comGB 2402635..2403672 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  J7W01_RS12210 (J7W01_12210) comGA 2403659..2404729 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  J7W01_RS12215 (J7W01_12215) corA 2405140..2406093 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=483841 J7W01_RS12185 WP_041850015.1 2401164..2401547(-) (comGF) [Bacillus subtilis strain YB-04]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=483841 J7W01_RS12185 WP_041850015.1 2401164..2401547(-) (comGF) [Bacillus subtilis strain YB-04]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984