Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IAU66_RS12480 Genome accession   NZ_CP061168
Coordinates   2592937..2593314 (-) Length   125 a.a.
NCBI ID   WP_003153092.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain T-5     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2587937..2598314
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAU66_RS12440 - 2588435..2589229 (+) 795 WP_003153106.1 YqhG family protein -
  IAU66_RS12445 sinI 2589406..2589579 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IAU66_RS12450 sinR 2589613..2589948 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IAU66_RS12455 tasA 2589996..2590781 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  IAU66_RS12460 sipW 2590845..2591429 (-) 585 WP_003153100.1 signal peptidase I SipW -
  IAU66_RS12465 tapA 2591401..2592072 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  IAU66_RS12470 - 2592332..2592661 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  IAU66_RS12475 - 2592701..2592880 (-) 180 WP_003153093.1 YqzE family protein -
  IAU66_RS12480 comGG 2592937..2593314 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  IAU66_RS12485 comGF 2593315..2593815 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  IAU66_RS12490 comGE 2593724..2594038 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IAU66_RS12495 comGD 2594022..2594459 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene
  IAU66_RS12500 comGC 2594449..2594757 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  IAU66_RS12505 comGB 2594762..2595799 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  IAU66_RS12510 comGA 2595786..2596856 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IAU66_RS12515 - 2597048..2597998 (-) 951 WP_014305415.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14169.15 Da        Isoelectric Point: 10.1579

>NTDB_id=481075 IAU66_RS12480 WP_003153092.1 2592937..2593314(-) (comGG) [Bacillus amyloliquefaciens strain T-5]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FRITGSNRRETVQVTIQAETVSGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=481075 IAU66_RS12480 WP_003153092.1 2592937..2593314(-) (comGG) [Bacillus amyloliquefaciens strain T-5]
ATGTACAAATCTGACGGTTTTATCTATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCGAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTACGGAACTGTTTCC
TTCCGCATCACCGGGAGTAATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCCGAAACAGTGTCAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512