Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   IAU66_RS12445 Genome accession   NZ_CP061168
Coordinates   2589406..2589579 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain T-5     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2584406..2594579
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAU66_RS12430 gcvT 2585224..2586324 (-) 1101 WP_024085597.1 glycine cleavage system aminomethyltransferase GcvT -
  IAU66_RS12435 - 2586747..2588417 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  IAU66_RS12440 - 2588435..2589229 (+) 795 WP_003153106.1 YqhG family protein -
  IAU66_RS12445 sinI 2589406..2589579 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IAU66_RS12450 sinR 2589613..2589948 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IAU66_RS12455 tasA 2589996..2590781 (-) 786 WP_015388008.1 biofilm matrix protein TasA -
  IAU66_RS12460 sipW 2590845..2591429 (-) 585 WP_003153100.1 signal peptidase I SipW -
  IAU66_RS12465 tapA 2591401..2592072 (-) 672 WP_024085598.1 amyloid fiber anchoring/assembly protein TapA -
  IAU66_RS12470 - 2592332..2592661 (+) 330 WP_024085599.1 DUF3889 domain-containing protein -
  IAU66_RS12475 - 2592701..2592880 (-) 180 WP_003153093.1 YqzE family protein -
  IAU66_RS12480 comGG 2592937..2593314 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  IAU66_RS12485 comGF 2593315..2593815 (-) 501 WP_223203779.1 competence type IV pilus minor pilin ComGF -
  IAU66_RS12490 comGE 2593724..2594038 (-) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  IAU66_RS12495 comGD 2594022..2594459 (-) 438 WP_024085600.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=481073 IAU66_RS12445 WP_003153105.1 2589406..2589579(+) (sinI) [Bacillus amyloliquefaciens strain T-5]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=481073 IAU66_RS12445 WP_003153105.1 2589406..2589579(+) (sinI) [Bacillus amyloliquefaciens strain T-5]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702