Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   IAR44_RS12100 Genome accession   NZ_CP061087
Coordinates   2538807..2539244 (-) Length   145 a.a.
NCBI ID   WP_043020787.1    Uniprot ID   -
Organism   Bacillus velezensis strain CLA178     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2533807..2544244
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAR44_RS12050 (IAR44_12050) sinI 2534190..2534363 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IAR44_RS12055 (IAR44_12055) sinR 2534397..2534732 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IAR44_RS12060 (IAR44_12060) tasA 2534780..2535565 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  IAR44_RS12065 (IAR44_12065) sipW 2535630..2536214 (-) 585 WP_015240205.1 signal peptidase I SipW -
  IAR44_RS12070 (IAR44_12070) tapA 2536186..2536857 (-) 672 WP_113766732.1 amyloid fiber anchoring/assembly protein TapA -
  IAR44_RS12075 (IAR44_12075) - 2537116..2537445 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  IAR44_RS12080 (IAR44_12080) - 2537486..2537665 (-) 180 WP_003153093.1 YqzE family protein -
  IAR44_RS12085 (IAR44_12085) comGG 2537722..2538099 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  IAR44_RS12090 (IAR44_12090) comGF 2538100..2538600 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  IAR44_RS12095 (IAR44_12095) comGE 2538509..2538823 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  IAR44_RS12100 (IAR44_12100) comGD 2538807..2539244 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  IAR44_RS12105 (IAR44_12105) comGC 2539234..2539542 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  IAR44_RS12110 (IAR44_12110) comGB 2539547..2540584 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  IAR44_RS12115 (IAR44_12115) comGA 2540571..2541641 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IAR44_RS12120 (IAR44_12120) - 2541834..2542784 (-) 951 WP_061890723.1 magnesium transporter CorA family protein -
  IAR44_RS12125 (IAR44_12125) - 2542930..2544231 (+) 1302 WP_012117986.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16271.77 Da        Isoelectric Point: 10.2475

>NTDB_id=480554 IAR44_RS12100 WP_043020787.1 2538807..2539244(-) (comGD) [Bacillus velezensis strain CLA178]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPAYTHLAVRQKTELLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=480554 IAR44_RS12100 WP_043020787.1 2538807..2539244(-) (comGD) [Bacillus velezensis strain CLA178]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGTCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACTGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566