Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IAR44_RS12085 Genome accession   NZ_CP061087
Coordinates   2537722..2538099 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis strain CLA178     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2532722..2543099
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAR44_RS12045 (IAR44_12045) - 2533219..2534013 (+) 795 WP_061860710.1 YqhG family protein -
  IAR44_RS12050 (IAR44_12050) sinI 2534190..2534363 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IAR44_RS12055 (IAR44_12055) sinR 2534397..2534732 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IAR44_RS12060 (IAR44_12060) tasA 2534780..2535565 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  IAR44_RS12065 (IAR44_12065) sipW 2535630..2536214 (-) 585 WP_015240205.1 signal peptidase I SipW -
  IAR44_RS12070 (IAR44_12070) tapA 2536186..2536857 (-) 672 WP_113766732.1 amyloid fiber anchoring/assembly protein TapA -
  IAR44_RS12075 (IAR44_12075) - 2537116..2537445 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  IAR44_RS12080 (IAR44_12080) - 2537486..2537665 (-) 180 WP_003153093.1 YqzE family protein -
  IAR44_RS12085 (IAR44_12085) comGG 2537722..2538099 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  IAR44_RS12090 (IAR44_12090) comGF 2538100..2538600 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  IAR44_RS12095 (IAR44_12095) comGE 2538509..2538823 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  IAR44_RS12100 (IAR44_12100) comGD 2538807..2539244 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene
  IAR44_RS12105 (IAR44_12105) comGC 2539234..2539542 (-) 309 WP_015417818.1 competence type IV pilus major pilin ComGC Machinery gene
  IAR44_RS12110 (IAR44_12110) comGB 2539547..2540584 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  IAR44_RS12115 (IAR44_12115) comGA 2540571..2541641 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  IAR44_RS12120 (IAR44_12120) - 2541834..2542784 (-) 951 WP_061890723.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=480553 IAR44_RS12085 WP_015417814.1 2537722..2538099(-) (comGG) [Bacillus velezensis strain CLA178]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=480553 IAR44_RS12085 WP_015417814.1 2537722..2538099(-) (comGG) [Bacillus velezensis strain CLA178]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACAGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504