Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   IAR44_RS12050 Genome accession   NZ_CP061087
Coordinates   2534190..2534363 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain CLA178     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2529190..2539363
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IAR44_RS12035 (IAR44_12035) gcvT 2530003..2531103 (-) 1101 WP_031378949.1 glycine cleavage system aminomethyltransferase GcvT -
  IAR44_RS12040 (IAR44_12040) - 2531527..2533197 (+) 1671 WP_031378948.1 DEAD/DEAH box helicase -
  IAR44_RS12045 (IAR44_12045) - 2533219..2534013 (+) 795 WP_061860710.1 YqhG family protein -
  IAR44_RS12050 (IAR44_12050) sinI 2534190..2534363 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  IAR44_RS12055 (IAR44_12055) sinR 2534397..2534732 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  IAR44_RS12060 (IAR44_12060) tasA 2534780..2535565 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  IAR44_RS12065 (IAR44_12065) sipW 2535630..2536214 (-) 585 WP_015240205.1 signal peptidase I SipW -
  IAR44_RS12070 (IAR44_12070) tapA 2536186..2536857 (-) 672 WP_113766732.1 amyloid fiber anchoring/assembly protein TapA -
  IAR44_RS12075 (IAR44_12075) - 2537116..2537445 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  IAR44_RS12080 (IAR44_12080) - 2537486..2537665 (-) 180 WP_003153093.1 YqzE family protein -
  IAR44_RS12085 (IAR44_12085) comGG 2537722..2538099 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  IAR44_RS12090 (IAR44_12090) comGF 2538100..2538600 (-) 501 WP_254922226.1 competence type IV pilus minor pilin ComGF -
  IAR44_RS12095 (IAR44_12095) comGE 2538509..2538823 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  IAR44_RS12100 (IAR44_12100) comGD 2538807..2539244 (-) 438 WP_043020787.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=480551 IAR44_RS12050 WP_003153105.1 2534190..2534363(+) (sinI) [Bacillus velezensis strain CLA178]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=480551 IAR44_RS12050 WP_003153105.1 2534190..2534363(+) (sinI) [Bacillus velezensis strain CLA178]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702