Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | H9Q12_RS05175 | Genome accession | NZ_CP060700 |
| Coordinates | 1091753..1092202 (-) | Length | 149 a.a. |
| NCBI ID | WP_131112717.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain Z0118SP0130 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1057903..1115942 | 1091753..1092202 | within | 0 |
Gene organization within MGE regions
Location: 1057903..1115942
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H9Q12_RS04955 | - | 1057903..1058835 (+) | 933 | WP_014613568.1 | leukocidin/hemolysin toxin family protein | - |
| H9Q12_RS04960 | - | 1058837..1059817 (+) | 981 | WP_014613567.1 | leukocidin/hemolysin toxin family protein | - |
| H9Q12_RS04965 | - | 1059876..1060460 (-) | 585 | WP_014613566.1 | DUF4355 domain-containing protein | - |
| H9Q12_RS04970 | - | 1060638..1060832 (-) | 195 | WP_014613564.1 | hypothetical protein | - |
| H9Q12_RS04975 | - | 1060829..1062175 (-) | 1347 | WP_014613563.1 | polymorphic toxin type 50 domain-containing protein | - |
| H9Q12_RS04980 | - | 1062540..1062653 (-) | 114 | WP_014613562.1 | putative holin-like toxin | - |
| H9Q12_RS04985 | - | 1063431..1063628 (-) | 198 | WP_101457754.1 | hypothetical protein | - |
| H9Q12_RS04990 | - | 1064107..1064559 (-) | 453 | WP_131112695.1 | hypothetical protein | - |
| H9Q12_RS04995 | - | 1064581..1065510 (-) | 930 | WP_131112696.1 | DUF6731 family protein | - |
| H9Q12_RS05000 | - | 1065765..1066712 (-) | 948 | WP_131112697.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| H9Q12_RS05005 | - | 1066728..1067162 (-) | 435 | WP_101457826.1 | holin family protein | - |
| H9Q12_RS05010 | - | 1067174..1068679 (-) | 1506 | WP_131112698.1 | hypothetical protein | - |
| H9Q12_RS05015 | - | 1068727..1070007 (-) | 1281 | WP_131112699.1 | phage baseplate upper protein | - |
| H9Q12_RS05020 | - | 1070026..1071024 (-) | 999 | WP_099994940.1 | SGNH/GDSL hydrolase family protein | - |
| H9Q12_RS05025 | - | 1071035..1071676 (-) | 642 | WP_037543732.1 | hypothetical protein | - |
| H9Q12_RS05030 | - | 1071679..1073094 (-) | 1416 | WP_131112700.1 | phage tail protein | - |
| H9Q12_RS05035 | - | 1073109..1074029 (-) | 921 | WP_187470841.1 | phage tail domain-containing protein | - |
| H9Q12_RS05040 | - | 1074042..1076885 (-) | 2844 | WP_187470842.1 | phage tail protein | - |
| H9Q12_RS05045 | - | 1076898..1077203 (-) | 306 | WP_233509769.1 | hypothetical protein | - |
| H9Q12_RS05050 | - | 1077314..1077667 (-) | 354 | WP_131112703.1 | tail assembly chaperone | - |
| H9Q12_RS05055 | - | 1077721..1078269 (-) | 549 | WP_165479880.1 | phage tail tube protein | - |
| H9Q12_RS05060 | - | 1078287..1078676 (-) | 390 | WP_131112705.1 | hypothetical protein | - |
| H9Q12_RS05065 | - | 1078682..1079032 (-) | 351 | WP_233519698.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| H9Q12_RS05070 | - | 1079010..1079333 (-) | 324 | WP_140239526.1 | hypothetical protein | - |
| H9Q12_RS05075 | - | 1079330..1079653 (-) | 324 | WP_020219859.1 | phage head-tail connector protein | - |
| H9Q12_RS12830 | - | 1079673..1080620 (-) | 948 | WP_233519697.1 | sugar-binding protein | - |
| H9Q12_RS05085 | - | 1080635..1081219 (-) | 585 | WP_131112707.1 | DUF4355 domain-containing protein | - |
| H9Q12_RS13045 | - | 1081403..1081534 (-) | 132 | WP_257975668.1 | hypothetical protein | - |
| H9Q12_RS05090 | - | 1081539..1083089 (-) | 1551 | WP_187470843.1 | minor capsid protein | - |
| H9Q12_RS05095 | - | 1083073..1084485 (-) | 1413 | WP_187470844.1 | phage portal protein | - |
| H9Q12_RS05100 | - | 1084495..1085745 (-) | 1251 | WP_131112710.1 | PBSX family phage terminase large subunit | - |
| H9Q12_RS05105 | - | 1085738..1086178 (-) | 441 | WP_131112711.1 | terminase small subunit | - |
| H9Q12_RS05110 | - | 1086403..1086822 (-) | 420 | WP_131112712.1 | transcriptional regulator | - |
| H9Q12_RS05115 | rinB | 1086819..1086986 (-) | 168 | WP_129948901.1 | transcriptional activator RinB | - |
| H9Q12_RS05120 | - | 1087002..1087190 (-) | 189 | WP_037542749.1 | DUF1381 domain-containing protein | - |
| H9Q12_RS05125 | - | 1087187..1087651 (-) | 465 | WP_129948902.1 | class I SAM-dependent methyltransferase | - |
| H9Q12_RS05130 | - | 1087688..1088176 (-) | 489 | WP_096636850.1 | dUTP diphosphatase | - |
| H9Q12_RS05135 | - | 1088169..1088396 (-) | 228 | WP_096636851.1 | hypothetical protein | - |
| H9Q12_RS05140 | - | 1088397..1088759 (-) | 363 | WP_131112713.1 | hypothetical protein | - |
| H9Q12_RS05145 | - | 1088948..1089160 (-) | 213 | WP_131091369.1 | hypothetical protein | - |
| H9Q12_RS05150 | - | 1089166..1089360 (-) | 195 | WP_051144748.1 | SAV1978 family virulence-associated passenger protein | - |
| H9Q12_RS05155 | - | 1089393..1089644 (-) | 252 | WP_131112714.1 | hypothetical protein | - |
| H9Q12_RS05160 | - | 1089791..1089997 (-) | 207 | WP_110148354.1 | hypothetical protein | - |
| H9Q12_RS05165 | - | 1090161..1090943 (-) | 783 | WP_131112715.1 | ATP-binding protein | - |
| H9Q12_RS05170 | - | 1090958..1091746 (-) | 789 | WP_131112716.1 | DnaD domain-containing protein | - |
| H9Q12_RS05175 | ssbA | 1091753..1092202 (-) | 450 | WP_131112717.1 | single-stranded DNA-binding protein | Machinery gene |
| H9Q12_RS05180 | - | 1092195..1092839 (-) | 645 | WP_222936269.1 | MBL fold metallo-hydrolase | - |
| H9Q12_RS05185 | - | 1092902..1093816 (-) | 915 | WP_131112719.1 | RecT family recombinase | - |
| H9Q12_RS13155 | - | 1093830..1094030 (-) | 201 | WP_129948906.1 | helix-turn-helix domain-containing protein | - |
| H9Q12_RS05195 | - | 1094024..1095970 (-) | 1947 | WP_131112720.1 | AAA family ATPase | - |
| H9Q12_RS05200 | - | 1095986..1096243 (-) | 258 | WP_037542870.1 | DUF1108 family protein | - |
| H9Q12_RS05205 | - | 1096323..1096637 (-) | 315 | WP_131112721.1 | DUF2482 family protein | - |
| H9Q12_RS05210 | - | 1096639..1096815 (-) | 177 | WP_165479882.1 | hypothetical protein | - |
| H9Q12_RS05215 | - | 1096830..1097039 (-) | 210 | WP_100006864.1 | hypothetical protein | - |
| H9Q12_RS05220 | - | 1097109..1097336 (+) | 228 | WP_096548968.1 | hypothetical protein | - |
| H9Q12_RS05225 | - | 1097333..1097500 (-) | 168 | WP_165443333.1 | hypothetical protein | - |
| H9Q12_RS05230 | - | 1097631..1098407 (-) | 777 | WP_100006865.1 | phage antirepressor | - |
| H9Q12_RS05235 | - | 1098464..1098964 (+) | 501 | WP_096533155.1 | hypothetical protein | - |
| H9Q12_RS05240 | - | 1098921..1099163 (-) | 243 | WP_100002386.1 | hypothetical protein | - |
| H9Q12_RS05245 | - | 1099180..1099419 (-) | 240 | WP_096548970.1 | helix-turn-helix domain-containing protein | - |
| H9Q12_RS05250 | - | 1099612..1099944 (+) | 333 | WP_096548971.1 | helix-turn-helix domain-containing protein | - |
| H9Q12_RS05255 | - | 1099958..1100410 (+) | 453 | WP_131112722.1 | ImmA/IrrE family metallo-endopeptidase | - |
| H9Q12_RS05260 | - | 1100454..1101773 (+) | 1320 | WP_131112723.1 | DUF4041 domain-containing protein | - |
| H9Q12_RS05265 | - | 1101836..1102882 (+) | 1047 | WP_065520443.1 | tyrosine-type recombinase/integrase | - |
| H9Q12_RS05315 | - | 1104187..1104741 (-) | 555 | WP_014613561.1 | RBBP9/YdeN family alpha/beta hydrolase | - |
| H9Q12_RS05320 | ltrA | 1105503..1106789 (+) | 1287 | WP_014613556.1 | group II intron reverse transcriptase/maturase | - |
| H9Q12_RS05325 | hemY | 1106867..1108270 (-) | 1404 | WP_014613560.1 | protoporphyrinogen oxidase | - |
| H9Q12_RS05330 | hemH | 1108276..1109208 (-) | 933 | WP_014613559.1 | ferrochelatase | - |
| H9Q12_RS05335 | hemE | 1109246..1110280 (-) | 1035 | WP_014613558.1 | uroporphyrinogen decarboxylase | - |
| H9Q12_RS05340 | - | 1110591..1111103 (+) | 513 | WP_014613557.1 | antibiotic biosynthesis monooxygenase | - |
| H9Q12_RS05345 | ltrA | 1111171..1112457 (-) | 1287 | WP_014613556.1 | group II intron reverse transcriptase/maturase | - |
| H9Q12_RS05350 | ecsB | 1112999..1114213 (-) | 1215 | WP_015729358.1 | ABC transporter permease EcsB | - |
| H9Q12_RS05355 | ecsA | 1114210..1114947 (-) | 738 | WP_014613554.1 | ABC transporter ATP-binding protein EcsA | - |
| H9Q12_RS05360 | - | 1115083..1115508 (+) | 426 | WP_063279146.1 | HIT family protein | - |
| H9Q12_RS05365 | - | 1115586..1115942 (+) | 357 | WP_014613552.1 | YtxH domain-containing protein | - |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16607.59 Da Isoelectric Point: 8.4781
>NTDB_id=477794 H9Q12_RS05175 WP_131112717.1 1091753..1092202(-) (ssbA) [Staphylococcus pseudintermedius strain Z0118SP0130]
MINRVVLVGRLTKNPELRHTPNGIIVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRLKSR
SYENKEGQRIYVTEVICDSVQFLEPKNTSQKQDGYTRGQNQSKQTQSEPSGHPLFANGPIDISDDDLPF
MINRVVLVGRLTKNPELRHTPNGIIVSSFTLAVNRTFTNAKGEREADFINCIAFKKTAENINNYLSKGSLAGVDGRLKSR
SYENKEGQRIYVTEVICDSVQFLEPKNTSQKQDGYTRGQNQSKQTQSEPSGHPLFANGPIDISDDDLPF
Nucleotide
Download Length: 450 bp
>NTDB_id=477794 H9Q12_RS05175 WP_131112717.1 1091753..1092202(-) (ssbA) [Staphylococcus pseudintermedius strain Z0118SP0130]
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGACATACACCAAATGGAATAATTGTTAG
CAGTTTCACACTCGCTGTAAATCGTACATTTACGAATGCAAAAGGTGAACGTGAAGCAGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGTCGTTTAAAATCACGC
AGTTACGAAAACAAAGAGGGACAACGCATATATGTCACTGAGGTGATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACTAGTCAAAAACAAGACGGTTATACAAGAGGGCAAAATCAATCAAAACAAACACAGTCAGAACCAAGTGGACACCCCC
TTTTTGCAAATGGTCCGATTGATATAAGTGATGATGATTTACCTTTCTAA
ATGATTAATAGAGTTGTACTTGTAGGTCGATTAACTAAAAATCCTGAATTAAGACATACACCAAATGGAATAATTGTTAG
CAGTTTCACACTCGCTGTAAATCGTACATTTACGAATGCAAAAGGTGAACGTGAAGCAGATTTTATTAACTGTATTGCCT
TTAAAAAAACAGCAGAGAACATTAATAACTACTTATCAAAAGGAAGTTTAGCAGGTGTTGATGGTCGTTTAAAATCACGC
AGTTACGAAAACAAAGAGGGACAACGCATATATGTCACTGAGGTGATATGTGACAGTGTTCAGTTTTTAGAACCTAAAAA
TACTAGTCAAAAACAAGACGGTTATACAAGAGGGCAAAATCAATCAAAACAAACACAGTCAGAACCAAGTGGACACCCCC
TTTTTGCAAATGGTCCGATTGATATAAGTGATGATGATTTACCTTTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.977 |
100 |
0.658 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.584 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.637 |
75.839 |
0.43 |
| ssbA | Streptococcus mutans UA159 |
38.926 |
100 |
0.389 |