Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   H9Q80_RS02170 Genome accession   NZ_CP060636
Coordinates   450662..451120 (-) Length   152 a.a.
NCBI ID   WP_117455396.1    Uniprot ID   -
Organism   [Eubacterium] hominis strain New-5     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 415622..464937 450662..451120 within 0


Gene organization within MGE regions


Location: 415622..464937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H9Q80_RS01980 (H9Q80_01980) - 415622..415957 (-) 336 WP_117455618.1 hypothetical protein -
  H9Q80_RS01985 (H9Q80_01985) - 416100..417452 (-) 1353 WP_117536165.1 MATE family efflux transporter -
  H9Q80_RS01990 (H9Q80_01990) - 417508..418272 (-) 765 WP_117536164.1 helix-turn-helix domain-containing protein -
  H9Q80_RS01995 (H9Q80_01995) ftsH 418400..420445 (-) 2046 WP_117455612.1 ATP-dependent zinc metalloprotease FtsH -
  H9Q80_RS02000 (H9Q80_02000) hpt 420464..421003 (-) 540 WP_117455610.1 hypoxanthine phosphoribosyltransferase -
  H9Q80_RS02005 (H9Q80_02005) tilS 421031..422251 (-) 1221 WP_117455608.1 tRNA lysidine(34) synthetase TilS -
  H9Q80_RS02010 (H9Q80_02010) - 422297..424153 (-) 1857 WP_187426233.1 SpoIIE family protein phosphatase -
  H9Q80_RS02015 (H9Q80_02015) - 424265..424591 (-) 327 WP_243205905.1 hypothetical protein -
  H9Q80_RS02020 (H9Q80_02020) - 424635..424811 (-) 177 WP_158552354.1 hypothetical protein -
  H9Q80_RS02025 (H9Q80_02025) - 425155..426153 (-) 999 WP_117455604.1 GH25 family lysozyme -
  H9Q80_RS02030 (H9Q80_02030) - 426156..426572 (-) 417 WP_117455602.1 hypothetical protein -
  H9Q80_RS02035 (H9Q80_02035) - 426576..426986 (-) 411 WP_117455600.1 hypothetical protein -
  H9Q80_RS02040 (H9Q80_02040) - 427011..433214 (-) 6204 WP_117570162.1 phage tail spike protein -
  H9Q80_RS02045 (H9Q80_02045) - 433246..433632 (-) 387 WP_117455347.1 hypothetical protein -
  H9Q80_RS02050 (H9Q80_02050) - 433635..433895 (-) 261 WP_117455349.1 hypothetical protein -
  H9Q80_RS02055 (H9Q80_02055) - 433914..434600 (-) 687 WP_117455350.1 phage distal tail protein -
  H9Q80_RS02060 (H9Q80_02060) - 434600..437437 (-) 2838 WP_187426234.1 phage tail tape measure protein -
  H9Q80_RS02065 (H9Q80_02065) - 437751..438050 (-) 300 WP_117455356.1 hypothetical protein -
  H9Q80_RS02070 (H9Q80_02070) - 438050..438616 (-) 567 WP_117455358.1 hypothetical protein -
  H9Q80_RS02075 (H9Q80_02075) - 438617..438970 (-) 354 WP_117455360.1 hypothetical protein -
  H9Q80_RS02080 (H9Q80_02080) - 438967..439380 (-) 414 WP_117455362.1 HK97-gp10 family putative phage morphogenesis protein -
  H9Q80_RS02085 (H9Q80_02085) - 439374..439673 (-) 300 WP_199483650.1 hypothetical protein -
  H9Q80_RS02090 (H9Q80_02090) - 439688..440005 (-) 318 WP_117455366.1 phage head-tail connector protein -
  H9Q80_RS02095 (H9Q80_02095) - 440036..440197 (-) 162 WP_158552347.1 hypothetical protein -
  H9Q80_RS02100 (H9Q80_02100) - 440201..441139 (-) 939 WP_117455368.1 SU10 major capsid protein -
  H9Q80_RS02105 (H9Q80_02105) - 441143..441763 (-) 621 WP_117536162.1 phage scaffolding protein -
  H9Q80_RS02110 (H9Q80_02110) - 442037..442501 (-) 465 WP_117455374.1 Gp49 family protein -
  H9Q80_RS02115 (H9Q80_02115) - 442557..442751 (-) 195 WP_117455376.1 hypothetical protein -
  H9Q80_RS02120 (H9Q80_02120) - 442756..443997 (-) 1242 WP_117455378.1 minor capsid protein -
  H9Q80_RS02125 (H9Q80_02125) - 443990..445429 (-) 1440 WP_117455380.1 phage portal protein -
  H9Q80_RS02130 (H9Q80_02130) - 445426..446685 (-) 1260 WP_117455382.1 PBSX family phage terminase large subunit -
  H9Q80_RS02135 (H9Q80_02135) - 446672..447586 (-) 915 WP_117455384.1 terminase small subunit -
  H9Q80_RS02140 (H9Q80_02140) - 447608..447988 (-) 381 WP_117455386.1 hypothetical protein -
  H9Q80_RS02145 (H9Q80_02145) - 447985..448164 (-) 180 WP_117455388.1 hypothetical protein -
  H9Q80_RS02150 (H9Q80_02150) - 448298..448756 (-) 459 WP_117536161.1 tetratricopeptide repeat protein -
  H9Q80_RS02155 (H9Q80_02155) - 449528..450112 (-) 585 WP_117455390.1 hypothetical protein -
  H9Q80_RS02160 (H9Q80_02160) - 450117..450317 (-) 201 WP_117455392.1 hypothetical protein -
  H9Q80_RS02165 (H9Q80_02165) - 450310..450645 (-) 336 WP_117455394.1 hypothetical protein -
  H9Q80_RS02170 (H9Q80_02170) ssbA 450662..451120 (-) 459 WP_117455396.1 single-stranded DNA-binding protein Machinery gene
  H9Q80_RS02175 (H9Q80_02175) - 451137..451847 (-) 711 WP_117455398.1 hypothetical protein -
  H9Q80_RS02180 (H9Q80_02180) - 451866..452492 (-) 627 WP_187426235.1 hypothetical protein -
  H9Q80_RS02185 (H9Q80_02185) - 452489..453331 (-) 843 WP_117455400.1 hypothetical protein -
  H9Q80_RS02190 (H9Q80_02190) - 453300..453959 (-) 660 WP_117455402.1 ThiF family adenylyltransferase -
  H9Q80_RS02195 (H9Q80_02195) - 453965..454306 (-) 342 WP_117455404.1 hypothetical protein -
  H9Q80_RS02200 (H9Q80_02200) - 454308..455279 (-) 972 WP_117455406.1 hypothetical protein -
  H9Q80_RS02205 (H9Q80_02205) - 455276..455461 (-) 186 WP_117455408.1 hypothetical protein -
  H9Q80_RS02210 (H9Q80_02210) - 455474..456472 (-) 999 WP_117455410.1 phosphoadenosine phosphosulfate reductase family protein -
  H9Q80_RS02215 (H9Q80_02215) - 456502..457407 (-) 906 WP_117536158.1 phage replisome organizer N-terminal domain-containing protein -
  H9Q80_RS02220 (H9Q80_02220) - 457435..457923 (-) 489 WP_117455416.1 hypothetical protein -
  H9Q80_RS02225 (H9Q80_02225) - 457932..458453 (-) 522 WP_117455418.1 hypothetical protein -
  H9Q80_RS02230 (H9Q80_02230) - 458446..458742 (-) 297 WP_117536157.1 hypothetical protein -
  H9Q80_RS02235 (H9Q80_02235) - 458727..459458 (-) 732 WP_158552348.1 ERF family protein -
  H9Q80_RS02240 (H9Q80_02240) - 459458..460270 (-) 813 WP_117455424.1 DUF1351 domain-containing protein -
  H9Q80_RS02245 (H9Q80_02245) - 460271..460678 (-) 408 WP_117455426.1 hypothetical protein -
  H9Q80_RS02250 (H9Q80_02250) - 460887..461588 (-) 702 WP_117455428.1 Rha family transcriptional regulator -
  H9Q80_RS02255 (H9Q80_02255) - 461848..462048 (-) 201 WP_117455433.1 hypothetical protein -
  H9Q80_RS02260 (H9Q80_02260) - 462075..462317 (-) 243 WP_117455435.1 helix-turn-helix transcriptional regulator -
  H9Q80_RS02265 (H9Q80_02265) - 462462..463097 (+) 636 WP_117455437.1 LexA family protein -
  H9Q80_RS02270 (H9Q80_02270) - 463150..463464 (+) 315 WP_117455439.1 hypothetical protein -
  H9Q80_RS02275 (H9Q80_02275) - 463597..464937 (+) 1341 WP_158552349.1 recombinase family protein -

Sequence

Protein


Download         Length: 152 a.a.        Molecular weight: 16769.74 Da        Isoelectric Point: 6.9511

>NTDB_id=476888 H9Q80_RS02170 WP_117455396.1 450662..451120(-) (ssbA) [[Eubacterium] hominis strain New-5]
MINRVVLVGRLTKDPVLRKTGAGKSVVSFTTACDRKVKAKGQPTADFINCIAWNKVADLMAQYLHKGSLVGVEGRIQTRS
YDDQTGKRIYITEVVADSVQFLESKSASTNNAQGGYTPDYNANNQDYEPDTSRASYPNDNDTLKIAEEDLPF

Nucleotide


Download         Length: 459 bp        

>NTDB_id=476888 H9Q80_RS02170 WP_117455396.1 450662..451120(-) (ssbA) [[Eubacterium] hominis strain New-5]
ATGATCAATCGAGTAGTATTAGTTGGCCGTCTTACAAAGGATCCAGTATTGCGCAAAACAGGTGCTGGTAAATCAGTAGT
ATCTTTTACCACCGCCTGTGACCGTAAGGTAAAGGCCAAGGGGCAACCTACAGCAGATTTTATCAATTGCATCGCTTGGA
ACAAAGTTGCTGATTTAATGGCACAATATCTTCACAAAGGAAGTCTAGTTGGAGTGGAAGGAAGAATCCAGACACGTAGC
TATGATGACCAAACAGGAAAGCGTATATATATTACCGAAGTGGTAGCAGATAGCGTACAATTCCTGGAAAGCAAATCCGC
TAGTACAAACAATGCACAAGGCGGATATACACCTGATTACAATGCAAATAACCAGGATTATGAACCAGATACATCACGAG
CATCTTATCCAAATGATAATGATACGCTTAAAATAGCTGAAGAAGATTTGCCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

42.938

100

0.5
  ssb Latilactobacillus sakei subsp. sakei 23K

41.176

100

0.461
  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

69.737

0.382
  ssbB Streptococcus sobrinus strain NIDR 6715-7

35.948

100

0.362