Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   H7F27_RS08685 Genome accession   NZ_CP060193
Coordinates   1708626..1709000 (+) Length   124 a.a.
NCBI ID   WP_185848830.1    Uniprot ID   A0A7G7UHU2
Organism   Bacillus sp. PAMC26543     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1703626..1714000
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7F27_RS08650 (H7F27_08650) - 1704328..1704738 (+) 411 WP_185848827.1 CBS domain-containing protein -
  H7F27_RS08655 (H7F27_08655) comGA 1705060..1706130 (+) 1071 WP_095713275.1 competence protein ComGA Machinery gene
  H7F27_RS08660 (H7F27_08660) comGB 1706117..1707154 (+) 1038 WP_185848828.1 competence type IV pilus assembly protein ComGB Machinery gene
  H7F27_RS08665 (H7F27_08665) comGC 1707168..1707464 (+) 297 WP_010334925.1 competence type IV pilus major pilin ComGC Machinery gene
  H7F27_RS08670 (H7F27_08670) comGD 1707454..1707885 (+) 432 WP_151175143.1 competence type IV pilus minor pilin ComGD Machinery gene
  H7F27_RS08675 (H7F27_08675) comGE 1707869..1708216 (+) 348 WP_185848829.1 competence type IV pilus minor pilin ComGE Machinery gene
  H7F27_RS08680 (H7F27_08680) comGF 1708242..1708625 (+) 384 WP_038954226.1 competence type IV pilus minor pilin ComGF Machinery gene
  H7F27_RS08685 (H7F27_08685) comGG 1708626..1709000 (+) 375 WP_185848830.1 competence type IV pilus minor pilin ComGG Machinery gene
  H7F27_RS08690 (H7F27_08690) - 1709072..1709251 (+) 180 WP_003236949.1 YqzE family protein -
  H7F27_RS08695 (H7F27_08695) - 1709293..1709616 (-) 324 WP_024122040.1 YqzG/YhdC family protein -
  H7F27_RS08700 (H7F27_08700) tapA 1709893..1710654 (+) 762 WP_185848831.1 amyloid fiber anchoring/assembly protein TapA -
  H7F27_RS08705 (H7F27_08705) sipW 1710626..1711210 (+) 585 WP_101861033.1 signal peptidase I SipW -
  H7F27_RS08710 (H7F27_08710) tasA 1711275..1712060 (+) 786 WP_024122037.1 biofilm matrix protein TasA -
  H7F27_RS08715 (H7F27_08715) sinR 1712147..1712482 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  H7F27_RS08720 (H7F27_08720) sinI 1712516..1712689 (-) 174 WP_024122036.1 anti-repressor SinI Regulator
  H7F27_RS08725 (H7F27_08725) - 1712873..1713667 (-) 795 WP_185848832.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14484.62 Da        Isoelectric Point: 9.5334

>NTDB_id=474505 H7F27_RS08685 WP_185848830.1 1708626..1709000(+) (comGG) [Bacillus sp. PAMC26543]
MYYSKGFIYPAVLFTFALVMLIVNFTAPQFVSRHMFEKETKEYYTGENLLQNGALLSIRHILEHRPGRKGSQQFQYGHVS
YDIRKTTIKEQQEITLKAITESGTEKNAQLLFDQSQKKLLSWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=474505 H7F27_RS08685 WP_185848830.1 1708626..1709000(+) (comGG) [Bacillus sp. PAMC26543]
ATGTACTACTCAAAAGGGTTTATCTATCCGGCTGTTCTTTTTACATTTGCCCTTGTGATGCTGATTGTGAATTTCACCGC
CCCTCAATTTGTTTCACGCCATATGTTTGAGAAGGAAACAAAAGAGTATTACACAGGAGAAAATCTGCTGCAAAATGGCG
CGCTTCTATCCATCAGGCATATACTTGAGCACAGACCAGGCCGAAAGGGTTCACAGCAGTTTCAATATGGACATGTATCT
TATGACATTCGCAAAACAACCATAAAAGAACAGCAAGAAATCACTCTTAAAGCCATCACAGAGTCGGGAACAGAAAAAAA
CGCTCAGCTGCTGTTCGATCAAAGTCAGAAAAAACTGCTGAGCTGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(31-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A7G7UHU2

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

69.355

100

0.694