Detailed information NTG0474473

Bioinformatically predicted

Overview

• Name: phrF
• Type: Regulator
• Locus tag: H7F27_RS02125
• Genome accession: NZ_CP060193
• Coordinates: 429837..429956 (-)
• Length: 39 a.a.
• NCBI ID: WP_185848497.1
• Uniprot ID: -
• Organism: Bacillus sp. PAMC26543
• Function: antagonize RapF (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IScluster/Tn	428550..429700	429837..429956	flank	137

Gene organization within MGE regions

Location: 428550..429956

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H7F27_RS02120 (H7F27_02120)	-	428550..429700 (+)	1151	WP_185848496.1	IS3 family transposase	-
H7F27_RS02125 (H7F27_02125)	phrF	429837..429956 (-)	120	WP_185848497.1	PhrC/PhrF family phosphatase-inhibitory pheromone	Regulator

Sequence

Protein

• Length: 39 a.a.
• Molecular weight: 4244.16 Da
• Isoelectric Point: 10.4997

>NTDB_id=474473 H7F27_RS02125 WP_185848497.1 429837..429956(-) (phrF) [Bacillus sp. PAMC26543]
MKLKSKLLLSCLALSTLFVATNIANAPTHQMEVAQRGMI

Nucleotide

• Length: 120 bp

>NTDB_id=474473 H7F27_RS02125 WP_185848497.1 429837..429956(-) (phrF) [Bacillus sp. PAMC26543]
ATGAAATTGAAGTCTAAGCTATTACTCTCTTGCCTGGCCCTAAGTACATTGTTTGTCGCAACGAATATTGCAAATGCACC
TACACACCAAATGGAAGTTGCACAGCGAGGAATGATTTAA

Domains

Predicted by InterproScan.

• Rap-phr extracellular signalling (PhrC_PhrF) (3-39)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
phrF	Bacillus subtilis subsp. subtilis str. 168	88.889	69.231	0.615
phrC	Bacillus subtilis subsp. subtilis str. 168	48.718	100	0.487