Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   JWY35_RS12765 Genome accession   NZ_CP070485
Coordinates   2373815..2374198 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain JNFE1126     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2368815..2379198
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JWY35_RS12725 (JWY35_12615) sinI 2369749..2369922 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  JWY35_RS12730 (JWY35_12620) sinR 2369956..2370291 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  JWY35_RS12735 (JWY35_12625) tasA 2370384..2371169 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  JWY35_RS12740 (JWY35_12630) sipW 2371233..2371805 (-) 573 WP_003230181.1 signal peptidase I SipW -
  JWY35_RS12745 (JWY35_12635) tapA 2371789..2372550 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  JWY35_RS12750 (JWY35_12640) yqzG 2372822..2373148 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  JWY35_RS12755 (JWY35_12645) spoIITA 2373190..2373369 (-) 180 WP_014480252.1 YqzE family protein -
  JWY35_RS12760 (JWY35_12650) comGG 2373440..2373814 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  JWY35_RS12765 (JWY35_12655) comGF 2373815..2374198 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  JWY35_RS12770 (JWY35_12660) comGE 2374224..2374571 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  JWY35_RS12775 (JWY35_12665) comGD 2374555..2374986 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  JWY35_RS12780 (JWY35_12670) comGC 2374976..2375272 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  JWY35_RS12785 (JWY35_12675) comGB 2375286..2376323 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  JWY35_RS12790 (JWY35_12680) comGA 2376310..2377380 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  JWY35_RS12795 (JWY35_12685) - 2377592..2377789 (-) 198 WP_014480259.1 CBS domain-containing protein -
  JWY35_RS12800 (JWY35_12690) corA 2377791..2378744 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=474472 JWY35_RS12765 WP_014480254.1 2373815..2374198(-) (comGF) [Bacillus subtilis strain JNFE1126]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=474472 JWY35_RS12765 WP_014480254.1 2373815..2374198(-) (comGF) [Bacillus subtilis strain JNFE1126]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984