Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   H5029_RS13595 Genome accession   NZ_CP060011
Coordinates   2893378..2893479 (-) Length   33 a.a.
NCBI ID   WP_168713084.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain TP2     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2891902..2945199 2893378..2893479 within 0


Gene organization within MGE regions


Location: 2891902..2945199
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H5029_RS13590 (H5029_13590) - 2891902..2892948 (-) 1047 WP_000027064.1 nucleoid-associated protein -
  H5029_RS13595 (H5029_13595) ssb 2893378..2893479 (-) 102 WP_168713084.1 single-stranded DNA-binding protein Machinery gene
  H5029_RS13600 (H5029_13600) - 2893461..2894903 (-) 1443 WP_000003535.1 hypothetical protein -
  H5029_RS18445 - 2895126..2895242 (-) 117 WP_001992235.1 single-stranded DNA-binding protein -
  H5029_RS13610 (H5029_13610) - 2895576..2898041 (-) 2466 WP_001022397.1 DUF927 domain-containing protein -
  H5029_RS13615 (H5029_13615) - 2898054..2898332 (-) 279 WP_001064707.1 hypothetical protein -
  H5029_RS13620 (H5029_13620) - 2898454..2898759 (-) 306 WP_000787149.1 hypothetical protein -
  H5029_RS13625 (H5029_13625) - 2898769..2899137 (-) 369 WP_001046481.1 hypothetical protein -
  H5029_RS13630 (H5029_13630) - 2899130..2899684 (-) 555 WP_001988245.1 Bro-N domain-containing protein -
  H5029_RS13635 (H5029_13635) - 2899681..2899890 (-) 210 WP_001016479.1 helix-turn-helix domain-containing protein -
  H5029_RS13640 (H5029_13640) - 2899893..2900108 (-) 216 WP_000153154.1 hypothetical protein -
  H5029_RS13645 (H5029_13645) - 2900318..2901085 (-) 768 WP_000578618.1 hypothetical protein -
  H5029_RS13650 (H5029_13650) - 2901233..2902462 (-) 1230 WP_001991065.1 tyrosine-type recombinase/integrase -
  H5029_RS13655 (H5029_13655) - 2902837..2903502 (-) 666 WP_001050362.1 hypothetical protein -
  H5029_RS13660 (H5029_13660) - 2903649..2904284 (+) 636 WP_000332605.1 SOS response-associated peptidase -
  H5029_RS13665 (H5029_13665) - 2904426..2904920 (+) 495 WP_000103869.1 LexA family protein -
  H5029_RS13670 (H5029_13670) - 2904924..2906222 (+) 1299 WP_000679995.1 Y-family DNA polymerase -
  H5029_RS13675 (H5029_13675) - 2906226..2906858 (+) 633 WP_001221425.1 hypothetical protein -
  H5029_RS13680 (H5029_13680) - 2906936..2907481 (-) 546 WP_001017971.1 glycoside hydrolase family 108 protein -
  H5029_RS13685 (H5029_13685) - 2907543..2907722 (-) 180 WP_001100986.1 hypothetical protein -
  H5029_RS13690 (H5029_13690) - 2907748..2908290 (-) 543 WP_001021568.1 hypothetical protein -
  H5029_RS13695 (H5029_13695) - 2908402..2908791 (-) 390 WP_000433923.1 hypothetical protein -
  H5029_RS13700 (H5029_13700) - 2908854..2911343 (-) 2490 WP_000509191.1 phage tail protein -
  H5029_RS13705 (H5029_13705) - 2911344..2911766 (-) 423 WP_000792725.1 C40 family peptidase -
  H5029_RS13710 (H5029_13710) - 2911817..2912587 (-) 771 WP_001072484.1 hypothetical protein -
  H5029_RS13715 (H5029_13715) - 2912590..2914407 (-) 1818 WP_000290423.1 sialate O-acetylesterase -
  H5029_RS13720 (H5029_13720) - 2914469..2915317 (-) 849 WP_001248147.1 DUF2163 domain-containing protein -
  H5029_RS13725 (H5029_13725) - 2915314..2915967 (-) 654 WP_001286153.1 DUF2460 domain-containing protein -
  H5029_RS13730 (H5029_13730) - 2915977..2919000 (-) 3024 WP_002022936.1 hypothetical protein -
  H5029_RS13735 (H5029_13735) - 2919069..2919779 (-) 711 WP_002128708.1 GDSL-type esterase/lipase family protein -
  H5029_RS13740 (H5029_13740) - 2919856..2920080 (-) 225 WP_000513917.1 hypothetical protein -
  H5029_RS13745 (H5029_13745) - 2920116..2920430 (-) 315 WP_001159818.1 hypothetical protein -
  H5029_RS13750 (H5029_13750) - 2920437..2921204 (-) 768 WP_000085037.1 hypothetical protein -
  H5029_RS13755 (H5029_13755) - 2921267..2921710 (-) 444 WP_000376613.1 hypothetical protein -
  H5029_RS13760 (H5029_13760) - 2921703..2922185 (-) 483 WP_001287057.1 hypothetical protein -
  H5029_RS13765 (H5029_13765) - 2922193..2922384 (-) 192 WP_001116149.1 hypothetical protein -
  H5029_RS13770 (H5029_13770) - 2922394..2922777 (-) 384 WP_000383144.1 DUF4054 domain-containing protein -
  H5029_RS13775 (H5029_13775) - 2922787..2923170 (-) 384 WP_000877806.1 hypothetical protein -
  H5029_RS13780 (H5029_13780) - 2923184..2924158 (-) 975 WP_000039807.1 DUF2184 domain-containing protein -
  H5029_RS13785 (H5029_13785) - 2924164..2924634 (-) 471 WP_000240723.1 hypothetical protein -
  H5029_RS13790 (H5029_13790) - 2924648..2925847 (-) 1200 WP_000794051.1 DUF2213 domain-containing protein -
  H5029_RS13795 (H5029_13795) - 2925900..2926205 (-) 306 WP_000823401.1 hypothetical protein -
  H5029_RS13800 (H5029_13800) - 2926474..2927286 (-) 813 WP_000207477.1 phage minor head protein -
  H5029_RS13805 (H5029_13805) - 2927231..2928565 (-) 1335 WP_000852316.1 DUF1073 domain-containing protein -
  H5029_RS13810 (H5029_13810) terL 2928574..2930100 (-) 1527 WP_001088664.1 phage terminase large subunit -
  H5029_RS13815 (H5029_13815) - 2930078..2930554 (-) 477 WP_000729394.1 DUF2280 domain-containing protein -
  H5029_RS13820 (H5029_13820) - 2930612..2931253 (-) 642 WP_000372129.1 putative metallopeptidase -
  H5029_RS13825 (H5029_13825) - 2931222..2931689 (-) 468 WP_000348738.1 hypothetical protein -
  H5029_RS13830 (H5029_13830) - 2931785..2932543 (-) 759 WP_000788352.1 hypothetical protein -
  H5029_RS13835 (H5029_13835) - 2932717..2932935 (-) 219 WP_024435039.1 hypothetical protein -
  H5029_RS13845 (H5029_13840) - 2933399..2934172 (-) 774 WP_000752807.1 hypothetical protein -
  H5029_RS13850 (H5029_13845) - 2934196..2934594 (-) 399 WP_001019813.1 antiterminator Q family protein -
  H5029_RS13855 (H5029_13850) - 2934594..2934998 (-) 405 WP_070129863.1 DUF559 domain-containing protein -
  H5029_RS13860 (H5029_13855) - 2934998..2935213 (-) 216 WP_070129862.1 hypothetical protein -
  H5029_RS13865 (H5029_13860) - 2935206..2935607 (-) 402 WP_070129861.1 HNH endonuclease -
  H5029_RS13870 (H5029_13865) - 2935604..2935729 (-) 126 WP_001031745.1 putative phage replication protein -
  H5029_RS13875 (H5029_13870) - 2935726..2936688 (-) 963 WP_000050657.1 helix-turn-helix domain-containing protein -
  H5029_RS13880 (H5029_13875) - 2936685..2936978 (-) 294 WP_001272098.1 hypothetical protein -
  H5029_RS13885 (H5029_13880) - 2936975..2937247 (-) 273 WP_001180652.1 hypothetical protein -
  H5029_RS13890 (H5029_13885) - 2937297..2937797 (-) 501 WP_001289843.1 phage regulatory CII family protein -
  H5029_RS13895 (H5029_13890) - 2937852..2938100 (-) 249 WP_000210973.1 transcriptional regulator -
  H5029_RS13900 (H5029_13895) - 2938103..2938894 (+) 792 WP_000187984.1 LexA family protein -
  H5029_RS13905 (H5029_13900) - 2939123..2939563 (+) 441 WP_001101439.1 hypothetical protein -
  H5029_RS13910 (H5029_13905) - 2939563..2939853 (+) 291 WP_000656409.1 hypothetical protein -
  H5029_RS13915 (H5029_13910) - 2939846..2940169 (+) 324 WP_000064478.1 hypothetical protein -
  H5029_RS13920 (H5029_13915) - 2940181..2941251 (+) 1071 WP_000215605.1 ATP-binding protein -
  H5029_RS13925 (H5029_13920) - 2941248..2942207 (+) 960 WP_001061222.1 hypothetical protein -
  H5029_RS13930 (H5029_13925) - 2942209..2942454 (+) 246 WP_000654841.1 hypothetical protein -
  H5029_RS13935 (H5029_13930) - 2942458..2942907 (+) 450 WP_000566258.1 DUF551 domain-containing protein -
  H5029_RS13940 (H5029_13935) - 2942904..2943188 (+) 285 WP_000048745.1 hypothetical protein -
  H5029_RS13945 (H5029_13940) - 2943199..2943369 (+) 171 WP_000119263.1 hypothetical protein -
  H5029_RS13950 (H5029_13945) - 2943380..2944048 (-) 669 WP_002052043.1 hypothetical protein -
  H5029_RS13955 (H5029_13950) - 2944048..2945199 (-) 1152 WP_000947479.1 tyrosine-type recombinase/integrase -

Sequence

Protein


Download         Length: 33 a.a.        Molecular weight: 3621.22 Da        Isoelectric Point: 9.7265

>NTDB_id=473319 H5029_RS13595 WP_168713084.1 2893378..2893479(-) (ssb) [Acinetobacter baumannii strain TP2]
MVSSQLAEISSKYLKKGGKVYVEGSLCTGKWKD

Nucleotide


Download         Length: 102 bp        

>NTDB_id=473319 H5029_RS13595 WP_168713084.1 2893378..2893479(-) (ssb) [Acinetobacter baumannii strain TP2]
TTGGTTAGTTCCCAATTAGCCGAGATTTCCAGTAAGTACCTTAAGAAAGGTGGCAAGGTTTATGTTGAGGGTTCATTGTG
TACTGGGAAGTGGAAAGACTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-33)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

62.963

81.818

0.515
  ssb Vibrio cholerae strain A1552

55.172

87.879

0.485
  ssb Neisseria gonorrhoeae MS11

53.571

84.848

0.455
  ssb Neisseria meningitidis MC58

53.571

84.848

0.455