Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | H2O77_RS05200 | Genome accession | NZ_CP059843 |
| Coordinates | 1226300..1226845 (-) | Length | 181 a.a. |
| NCBI ID | WP_215824073.1 | Uniprot ID | - |
| Organism | Cobetia sp. 4B | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1215204..1263674 | 1226300..1226845 | within | 0 |
Gene organization within MGE regions
Location: 1215204..1263674
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H2O77_RS05145 (H2O77_05145) | - | 1215204..1216127 (-) | 924 | WP_054554924.1 | LysR family transcriptional regulator | - |
| H2O77_RS05150 (H2O77_05150) | trpB | 1216362..1217603 (+) | 1242 | WP_215824065.1 | tryptophan synthase subunit beta | - |
| H2O77_RS05155 (H2O77_05155) | trpA | 1217730..1218569 (+) | 840 | WP_107335249.1 | tryptophan synthase subunit alpha | - |
| H2O77_RS05160 (H2O77_05160) | - | 1218739..1219524 (-) | 786 | WP_215824066.1 | alpha/beta fold hydrolase | - |
| H2O77_RS05165 (H2O77_05165) | - | 1220075..1222426 (+) | 2352 | WP_215824067.1 | EAL domain-containing protein | - |
| H2O77_RS05175 (H2O77_05175) | - | 1222856..1224100 (+) | 1245 | WP_215824068.1 | tyrosine-type recombinase/integrase | - |
| H2O77_RS05180 (H2O77_05180) | - | 1224069..1224302 (-) | 234 | WP_215824069.1 | AlpA family phage regulatory protein | - |
| H2O77_RS05185 (H2O77_05185) | - | 1224316..1224465 (-) | 150 | WP_215824070.1 | hypothetical protein | - |
| H2O77_RS05190 (H2O77_05190) | - | 1224650..1225564 (-) | 915 | WP_215824071.1 | DNA cytosine methyltransferase | - |
| H2O77_RS05195 (H2O77_05195) | - | 1225561..1226190 (-) | 630 | WP_215824072.1 | hypothetical protein | - |
| H2O77_RS05200 (H2O77_05200) | ssb | 1226300..1226845 (-) | 546 | WP_215824073.1 | single-stranded DNA-binding protein | Machinery gene |
| H2O77_RS05205 (H2O77_05205) | - | 1227221..1227748 (+) | 528 | WP_215824074.1 | hypothetical protein | - |
| H2O77_RS05210 (H2O77_05210) | - | 1228104..1228430 (-) | 327 | WP_215824075.1 | hypothetical protein | - |
| H2O77_RS05215 (H2O77_05215) | - | 1228735..1229610 (-) | 876 | WP_240548720.1 | helix-turn-helix transcriptional regulator | - |
| H2O77_RS05220 (H2O77_05220) | - | 1229533..1229751 (+) | 219 | WP_215824077.1 | Cro/CI family transcriptional regulator | - |
| H2O77_RS05225 (H2O77_05225) | - | 1229814..1230308 (+) | 495 | WP_215824078.1 | phage regulatory CII family protein | - |
| H2O77_RS05230 (H2O77_05230) | - | 1230391..1230717 (+) | 327 | WP_215824079.1 | hypothetical protein | - |
| H2O77_RS05235 (H2O77_05235) | - | 1231049..1231861 (+) | 813 | WP_215824080.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| H2O77_RS05240 (H2O77_05240) | - | 1231800..1232543 (+) | 744 | WP_215824081.1 | replication protein P | - |
| H2O77_RS05245 (H2O77_05245) | - | 1232536..1232892 (+) | 357 | WP_215824082.1 | hypothetical protein | - |
| H2O77_RS05250 (H2O77_05250) | - | 1233074..1233358 (+) | 285 | WP_176676551.1 | hypothetical protein | - |
| H2O77_RS05255 (H2O77_05255) | - | 1233355..1233891 (+) | 537 | WP_240548721.1 | VRR-NUC domain-containing protein | - |
| H2O77_RS05260 (H2O77_05260) | - | 1233914..1234474 (+) | 561 | WP_215824083.1 | hypothetical protein | - |
| H2O77_RS05265 (H2O77_05265) | - | 1235198..1235728 (+) | 531 | WP_215824084.1 | glycoside hydrolase family 104 protein | - |
| H2O77_RS05270 (H2O77_05270) | - | 1235773..1236126 (+) | 354 | WP_131431534.1 | phage holin, lambda family | - |
| H2O77_RS05275 (H2O77_05275) | - | 1236114..1236539 (+) | 426 | WP_175089174.1 | hypothetical protein | - |
| H2O77_RS05280 (H2O77_05280) | - | 1236523..1236750 (+) | 228 | WP_215824085.1 | hypothetical protein | - |
| H2O77_RS05285 (H2O77_05285) | - | 1236930..1237505 (+) | 576 | WP_215824086.1 | KilA-N domain-containing protein | - |
| H2O77_RS05290 (H2O77_05290) | - | 1237523..1237714 (-) | 192 | WP_215824087.1 | DUF2188 domain-containing protein | - |
| H2O77_RS05300 (H2O77_05300) | - | 1238099..1238437 (+) | 339 | WP_240548722.1 | HNH endonuclease | - |
| H2O77_RS05305 (H2O77_05305) | - | 1238550..1239029 (+) | 480 | WP_215824089.1 | phage terminase small subunit P27 family | - |
| H2O77_RS05310 (H2O77_05310) | - | 1239036..1240745 (+) | 1710 | WP_166019414.1 | terminase TerL endonuclease subunit | - |
| H2O77_RS05315 (H2O77_05315) | - | 1240747..1240911 (+) | 165 | WP_166019415.1 | hypothetical protein | - |
| H2O77_RS05320 (H2O77_05320) | - | 1240908..1242128 (+) | 1221 | WP_215824090.1 | phage portal protein | - |
| H2O77_RS05325 (H2O77_05325) | - | 1242125..1242727 (+) | 603 | WP_084208182.1 | HK97 family phage prohead protease | - |
| H2O77_RS05330 (H2O77_05330) | - | 1242743..1243978 (+) | 1236 | WP_215824091.1 | phage major capsid protein | - |
| H2O77_RS05335 (H2O77_05335) | - | 1244056..1244385 (+) | 330 | WP_215824092.1 | head-tail connector protein | - |
| H2O77_RS05340 (H2O77_05340) | - | 1244393..1244938 (+) | 546 | WP_215824093.1 | head-tail adaptor protein | - |
| H2O77_RS05345 (H2O77_05345) | - | 1244950..1245528 (+) | 579 | WP_215824094.1 | phage tail protein | - |
| H2O77_RS05350 (H2O77_05350) | - | 1245525..1245965 (+) | 441 | WP_215824095.1 | hypothetical protein | - |
| H2O77_RS05355 (H2O77_05355) | - | 1245969..1246715 (+) | 747 | WP_215824096.1 | hypothetical protein | - |
| H2O77_RS05360 (H2O77_05360) | - | 1246728..1246901 (+) | 174 | WP_215824097.1 | hypothetical protein | - |
| H2O77_RS05365 (H2O77_05365) | - | 1246973..1250776 (+) | 3804 | WP_215824098.1 | hypothetical protein | - |
| H2O77_RS05370 (H2O77_05370) | - | 1250810..1251208 (+) | 399 | WP_215824099.1 | hypothetical protein | - |
| H2O77_RS05375 (H2O77_05375) | - | 1251237..1254611 (+) | 3375 | WP_215824100.1 | hypothetical protein | - |
| H2O77_RS05380 (H2O77_05380) | - | 1254692..1255849 (+) | 1158 | WP_215824101.1 | hypothetical protein | - |
| H2O77_RS05385 (H2O77_05385) | - | 1255850..1257535 (+) | 1686 | WP_215824102.1 | LamG-like jellyroll fold domain-containing protein | - |
| H2O77_RS05390 (H2O77_05390) | - | 1257532..1257933 (+) | 402 | WP_215824103.1 | hypothetical protein | - |
| H2O77_RS05395 (H2O77_05395) | - | 1257935..1259803 (+) | 1869 | WP_215824104.1 | hypothetical protein | - |
| H2O77_RS05400 (H2O77_05400) | - | 1259846..1260067 (+) | 222 | WP_215824105.1 | hypothetical protein | - |
| H2O77_RS05405 (H2O77_05405) | - | 1260129..1262654 (-) | 2526 | WP_215824106.1 | S8 family peptidase | - |
| H2O77_RS05410 (H2O77_05410) | - | 1262685..1263674 (-) | 990 | WP_215824107.1 | ATP-binding protein | - |
Sequence
Protein
Download Length: 181 a.a. Molecular weight: 19925.98 Da Isoelectric Point: 6.8812
>NTDB_id=472190 H2O77_RS05200 WP_215824073.1 1226300..1226845(-) (ssb) [Cobetia sp. 4B]
MARGINKAILIGHLGQDPEVRFTPSGSAVANLSIATTDKWRDRQTGNVQERTEWHRVVMFNKTAEIAQQYLKKGAQVYIE
GRLQTRKWTDQQGIERYSTEIVANDMQMLGGSGGGQPSQAQRPPAQQNYQQPPQQQGGYQQPAPASTHHGVGQPPAGQQQ
PNNFGAPPAGSFDDFDDEIPF
MARGINKAILIGHLGQDPEVRFTPSGSAVANLSIATTDKWRDRQTGNVQERTEWHRVVMFNKTAEIAQQYLKKGAQVYIE
GRLQTRKWTDQQGIERYSTEIVANDMQMLGGSGGGQPSQAQRPPAQQNYQQPPQQQGGYQQPAPASTHHGVGQPPAGQQQ
PNNFGAPPAGSFDDFDDEIPF
Nucleotide
Download Length: 546 bp
>NTDB_id=472190 H2O77_RS05200 WP_215824073.1 1226300..1226845(-) (ssb) [Cobetia sp. 4B]
ATGGCCCGCGGCATCAACAAGGCGATCCTGATCGGCCATCTCGGCCAAGACCCAGAGGTGCGCTTCACCCCCAGCGGCTC
AGCCGTGGCCAACCTCAGCATCGCCACCACCGACAAGTGGCGAGACAGGCAGACCGGCAACGTCCAAGAACGCACCGAAT
GGCATCGGGTGGTGATGTTCAACAAGACCGCCGAGATCGCTCAGCAGTACCTCAAGAAAGGCGCTCAGGTGTATATCGAA
GGACGCTTGCAGACTCGCAAGTGGACGGACCAGCAAGGCATCGAACGCTACAGCACCGAGATCGTCGCCAATGACATGCA
GATGCTCGGCGGTTCCGGTGGCGGTCAGCCATCCCAGGCACAGCGTCCGCCAGCTCAGCAGAACTATCAGCAGCCACCCC
AGCAGCAAGGCGGCTATCAGCAACCGGCGCCCGCCAGCACGCACCACGGTGTAGGTCAGCCACCTGCAGGCCAACAACAG
CCGAACAACTTCGGGGCTCCGCCAGCCGGCAGCTTCGATGACTTTGATGACGAGATCCCGTTCTAG
ATGGCCCGCGGCATCAACAAGGCGATCCTGATCGGCCATCTCGGCCAAGACCCAGAGGTGCGCTTCACCCCCAGCGGCTC
AGCCGTGGCCAACCTCAGCATCGCCACCACCGACAAGTGGCGAGACAGGCAGACCGGCAACGTCCAAGAACGCACCGAAT
GGCATCGGGTGGTGATGTTCAACAAGACCGCCGAGATCGCTCAGCAGTACCTCAAGAAAGGCGCTCAGGTGTATATCGAA
GGACGCTTGCAGACTCGCAAGTGGACGGACCAGCAAGGCATCGAACGCTACAGCACCGAGATCGTCGCCAATGACATGCA
GATGCTCGGCGGTTCCGGTGGCGGTCAGCCATCCCAGGCACAGCGTCCGCCAGCTCAGCAGAACTATCAGCAGCCACCCC
AGCAGCAAGGCGGCTATCAGCAACCGGCGCCCGCCAGCACGCACCACGGTGTAGGTCAGCCACCTGCAGGCCAACAACAG
CCGAACAACTTCGGGGCTCCGCCAGCCGGCAGCTTCGATGACTTTGATGACGAGATCCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
52.406 |
100 |
0.541 |
| ssb | Neisseria gonorrhoeae MS11 |
50 |
99.448 |
0.497 |
| ssb | Neisseria meningitidis MC58 |
49.444 |
99.448 |
0.492 |
| ssb | Glaesserella parasuis strain SC1401 |
46.237 |
100 |
0.475 |