Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   KHP_RS06600 Genome accession   NC_017382
Coordinates   1353336..1353461 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori 51     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1348336..1358461
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KHP_RS06580 (KHP_1239) - 1349020..1350432 (-) 1413 WP_000694858.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  KHP_RS06585 (KHP_1240) comB10 1350502..1351638 (-) 1137 WP_001045729.1 DNA type IV secretion system protein ComB10 Machinery gene
  KHP_RS06590 (KHP_1241) comB9 1351631..1352596 (-) 966 WP_014537399.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  KHP_RS06595 (KHP_1242) comB8 1352596..1353339 (-) 744 WP_000660524.1 type IV secretion system protein Machinery gene
  KHP_RS06600 (KHP_1243) comB7 1353336..1353461 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  KHP_RS06605 (KHP_1244) comB6 1353477..1354532 (-) 1056 WP_000786701.1 P-type conjugative transfer protein TrbL Machinery gene
  KHP_RS06610 (KHP_1245) - 1354540..1355535 (-) 996 WP_000468804.1 PDZ domain-containing protein -
  KHP_RS06615 (KHP_1246) - 1355535..1355828 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  KHP_RS06620 (KHP_1247) panD 1355839..1356189 (-) 351 WP_000142208.1 aspartate 1-decarboxylase -
  KHP_RS06625 (KHP_1248) - 1356179..1358401 (-) 2223 WP_001051520.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=47115 KHP_RS06600 WP_001217874.1 1353336..1353461(-) (comB7) [Helicobacter pylori 51]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=47115 KHP_RS06600 WP_001217874.1 1353336..1353461(-) (comB7) [Helicobacter pylori 51]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment