Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPPN135_RS00195 Genome accession   NC_017379
Coordinates   35490..35603 (+) Length   37 a.a.
NCBI ID   WP_001217868.1    Uniprot ID   A0AAE7DTV1
Organism   Helicobacter pylori Puno135     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 30490..40603
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPPN135_RS00170 (HPPN135_00160) - 30537..32759 (+) 2223 WP_001051546.1 AAA family ATPase -
  HPPN135_RS00175 (HPPN135_00165) panD 32749..33099 (+) 351 WP_000142283.1 aspartate 1-decarboxylase -
  HPPN135_RS00180 (HPPN135_00170) - 33110..33403 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  HPPN135_RS00185 (HPPN135_00175) - 33403..34410 (+) 1008 WP_000233426.1 PDZ domain-containing protein -
  HPPN135_RS00190 (HPPN135_00180) comB6 34418..35473 (+) 1056 WP_000786661.1 P-type conjugative transfer protein TrbL Machinery gene
  HPPN135_RS00195 (HPPN135_00185) comB7 35490..35603 (+) 114 WP_001217868.1 hypothetical protein Machinery gene
  HPPN135_RS00200 (HPPN135_00190) comB8 35600..36343 (+) 744 WP_000660514.1 type IV secretion system protein Machinery gene
  HPPN135_RS00205 (HPPN135_00195) comB9 36343..37305 (+) 963 WP_014537031.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPPN135_RS00210 (HPPN135_00200) comB10 37298..38434 (+) 1137 WP_001045878.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPPN135_RS00215 (HPPN135_00205) - 38504..39916 (+) 1413 WP_000694825.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4323.29 Da        Isoelectric Point: 9.3572

>NTDB_id=47061 HPPN135_RS00195 WP_001217868.1 35490..35603(+) (comB7) [Helicobacter pylori Puno135]
MRIFFVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=47061 HPPN135_RS00195 WP_001217868.1 35490..35603(+) (comB7) [Helicobacter pylori Puno135]
ATGAGAATTTTTTTTGTTATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACACTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

91.892

100

0.919


Multiple sequence alignment