Detailed information NTG0470249

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: H2N97_RS20510
• Genome accession: NZ_CP059497
• Coordinates: 4119704..4120222 (-)
• Length: 172 a.a.
• NCBI ID: WP_004392979.1
• Uniprot ID: A0A9Q3LJE1
• Organism: Bacillus velezensis strain JSRB 08
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	4109314..4120549	4119704..4120222	within	0

Gene organization within MGE regions

Location: 4109314..4120549

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H2N97_RS20445 (H2N97_20445)	-	4109314..4109470 (+)	157	Protein_4016	DUF255 domain-containing protein	-
H2N97_RS20450 (H2N97_20450)	-	4109632..4110444 (+)	813	WP_048367898.1	MerR family transcriptional regulator	-
H2N97_RS20455 (H2N97_20455)	-	4110513..4111202 (+)	690	WP_110085264.1	DUF554 domain-containing protein	-
H2N97_RS20460 (H2N97_20460)	-	4111349..4111504 (+)	156	Protein_4019	DUF255 domain-containing protein	-
H2N97_RS20465 (H2N97_20465)	-	4111540..4113429 (+)	1890	WP_134986804.1	thioredoxin domain-containing protein	-
H2N97_RS20470 (H2N97_20470)	-	4113426..4114322 (-)	897	WP_017418443.1	CPBP family intramembrane glutamic endopeptidase	-
H2N97_RS20475 (H2N97_20475)	-	4114537..4115868 (+)	1332	WP_014419380.1	MFS transporter	-
H2N97_RS20480 (H2N97_20480)	-	4115902..4116282 (-)	381	WP_017418442.1	VOC family protein	-
H2N97_RS20485 (H2N97_20485)	-	4116339..4117277 (-)	939	WP_017418441.1	LacI family DNA-binding transcriptional regulator	-
H2N97_RS20490 (H2N97_20490)	xth	4117340..4118098 (-)	759	WP_017418440.1	exodeoxyribonuclease III	-
H2N97_RS20495 (H2N97_20495)	-	4118095..4118652 (-)	558	WP_017418439.1	methylated-DNA--[protein]-cysteine S-methyltransferase	-
H2N97_RS20500 (H2N97_20500)	-	4118649..4119230 (-)	582	WP_017418438.1	bifunctional transcriptional activator/DNA repair enzyme AdaA	-
H2N97_RS20505 (H2N97_20505)	rpsR	4119421..4119660 (-)	240	WP_004392983.1	30S ribosomal protein S18	-
H2N97_RS20510 (H2N97_20510)	ssbA	4119704..4120222 (-)	519	WP_004392979.1	single-stranded DNA-binding protein SsbA	Machinery gene
H2N97_RS20515 (H2N97_20515)	rpsF	4120262..4120549 (-)	288	WP_004392977.1	30S ribosomal protein S6	-

Sequence

Protein

• Length: 172 a.a.
• Molecular weight: 18745.31 Da
• Isoelectric Point: 4.7621

>NTDB_id=470249 H2N97_RS20510 WP_004392979.1 4119704..4120222(-) (ssbA) [Bacillus velezensis strain JSRB 08]
MLNRVVLVGRLTKDPELRYTPSGAAVATFTLAVNRTFTNQSGEREADFINCVTWRRQAENVANFLKKGSLAGVDGRLQTR
NYENQQGQRVFVTEVQAESVQFLEPKNSGGSGSGGYNEGNSGGGQYFGGGQNDNPFGGNQNNQRRNQGNSFNDDPFANDG
KPIDISDDDLPF

Nucleotide

• Length: 519 bp

>NTDB_id=470249 H2N97_RS20510 WP_004392979.1 4119704..4120222(-) (ssbA) [Bacillus velezensis strain JSRB 08]
ATGCTTAACCGAGTTGTATTAGTCGGAAGACTGACAAAAGACCCAGAGCTTCGTTATACGCCAAGCGGTGCGGCTGTCGC
CACGTTTACTCTTGCTGTGAATCGTACATTCACGAACCAGTCCGGAGAACGTGAAGCCGATTTCATTAATTGTGTCACTT
GGAGAAGACAAGCCGAAAACGTTGCAAACTTTCTTAAAAAAGGAAGCCTTGCCGGCGTAGACGGCCGACTCCAGACAAGA
AATTATGAAAACCAGCAGGGACAGCGTGTCTTCGTGACAGAAGTCCAAGCTGAAAGTGTTCAATTTCTTGAGCCTAAAAA
CAGCGGCGGTTCTGGATCAGGCGGATACAACGAAGGAAACAGCGGCGGAGGCCAATACTTTGGCGGAGGCCAAAATGATA
ATCCGTTCGGCGGAAATCAGAACAACCAGAGACGAAATCAAGGGAACAGCTTTAATGATGATCCATTTGCCAACGACGGC
AAGCCGATTGACATCTCGGATGATGATCTTCCGTTCTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	98.837	100	0.988
ssb	Latilactobacillus sakei subsp. sakei 23K	58.757	100	0.605
ssbB	Bacillus subtilis subsp. subtilis str. 168	64.151	61.628	0.395
ssb	Glaesserella parasuis strain SC1401	35.519	100	0.378