Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   H2N97_RS12705 Genome accession   NZ_CP059497
Coordinates   2603168..2603605 (-) Length   145 a.a.
NCBI ID   WP_007612572.1    Uniprot ID   -
Organism   Bacillus velezensis strain JSRB 08     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2598168..2608605
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N97_RS12655 (H2N97_12655) sinI 2598551..2598724 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  H2N97_RS12660 (H2N97_12660) sinR 2598758..2599093 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H2N97_RS12665 (H2N97_12665) tasA 2599141..2599926 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  H2N97_RS12670 (H2N97_12670) sipW 2599991..2600575 (-) 585 WP_012117977.1 signal peptidase I SipW -
  H2N97_RS12675 (H2N97_12675) tapA 2600547..2601218 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  H2N97_RS12680 (H2N97_12680) - 2601477..2601806 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H2N97_RS12685 (H2N97_12685) - 2601847..2602026 (-) 180 WP_003153093.1 YqzE family protein -
  H2N97_RS12690 (H2N97_12690) comGG 2602083..2602460 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  H2N97_RS12695 (H2N97_12695) comGF 2602461..2602856 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  H2N97_RS12700 (H2N97_12700) comGE 2602870..2603184 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  H2N97_RS12705 (H2N97_12705) comGD 2603168..2603605 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  H2N97_RS12710 (H2N97_12710) comGC 2603595..2603903 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  H2N97_RS12715 (H2N97_12715) comGB 2603908..2604945 (-) 1038 WP_014418377.1 competence type IV pilus assembly protein ComGB Machinery gene
  H2N97_RS12720 (H2N97_12720) comGA 2604932..2606002 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  H2N97_RS12725 (H2N97_12725) - 2606195..2607145 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -
  H2N97_RS12730 (H2N97_12730) - 2607291..2608592 (+) 1302 WP_017418142.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16254.76 Da        Isoelectric Point: 10.1850

>NTDB_id=470217 H2N97_RS12705 WP_007612572.1 2603168..2603605(-) (comGD) [Bacillus velezensis strain JSRB 08]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=470217 H2N97_RS12705 WP_007612572.1 2603168..2603605(-) (comGD) [Bacillus velezensis strain JSRB 08]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGATTCGCTTCACATTACGCTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATACAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

55.479

100

0.559