Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   H2N97_RS12655 Genome accession   NZ_CP059497
Coordinates   2598551..2598724 (+) Length   57 a.a.
NCBI ID   WP_014418369.1    Uniprot ID   I2C7P2
Organism   Bacillus velezensis strain JSRB 08     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2593551..2603724
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H2N97_RS12640 (H2N97_12640) gcvT 2594364..2595464 (-) 1101 WP_134986820.1 glycine cleavage system aminomethyltransferase GcvT -
  H2N97_RS12645 (H2N97_12645) - 2595888..2597558 (+) 1671 WP_017418135.1 DEAD/DEAH box helicase -
  H2N97_RS12650 (H2N97_12650) - 2597580..2598374 (+) 795 WP_014305407.1 YqhG family protein -
  H2N97_RS12655 (H2N97_12655) sinI 2598551..2598724 (+) 174 WP_014418369.1 anti-repressor SinI Regulator
  H2N97_RS12660 (H2N97_12660) sinR 2598758..2599093 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  H2N97_RS12665 (H2N97_12665) tasA 2599141..2599926 (-) 786 WP_017418136.1 biofilm matrix protein TasA -
  H2N97_RS12670 (H2N97_12670) sipW 2599991..2600575 (-) 585 WP_012117977.1 signal peptidase I SipW -
  H2N97_RS12675 (H2N97_12675) tapA 2600547..2601218 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  H2N97_RS12680 (H2N97_12680) - 2601477..2601806 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  H2N97_RS12685 (H2N97_12685) - 2601847..2602026 (-) 180 WP_003153093.1 YqzE family protein -
  H2N97_RS12690 (H2N97_12690) comGG 2602083..2602460 (-) 378 WP_025649851.1 competence type IV pilus minor pilin ComGG Machinery gene
  H2N97_RS12695 (H2N97_12695) comGF 2602461..2602856 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  H2N97_RS12700 (H2N97_12700) comGE 2602870..2603184 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  H2N97_RS12705 (H2N97_12705) comGD 2603168..2603605 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6642.60 Da        Isoelectric Point: 9.8168

>NTDB_id=470213 H2N97_RS12655 WP_014418369.1 2598551..2598724(+) (sinI) [Bacillus velezensis strain JSRB 08]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=470213 H2N97_RS12655 WP_014418369.1 2598551..2598724(+) (sinI) [Bacillus velezensis strain JSRB 08]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C7P2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

71.93

100

0.719