Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSNT_RS00195 Genome accession   NC_017376
Coordinates   37128..37241 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori SNT49     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32128..42241
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSNT_RS00170 (HPSNT_00155) - 32181..34406 (+) 2226 WP_001051471.1 AAA family ATPase -
  HPSNT_RS00175 (HPSNT_00160) panD 34396..34749 (+) 354 WP_000142229.1 aspartate 1-decarboxylase -
  HPSNT_RS00180 (HPSNT_00165) - 34752..35045 (+) 294 WP_000347915.1 YbaB/EbfC family nucleoid-associated protein -
  HPSNT_RS00185 (HPSNT_00170) - 35045..36049 (+) 1005 WP_000468459.1 PDZ domain-containing protein -
  HPSNT_RS00190 (HPSNT_00175) comB6 36057..37112 (+) 1056 WP_000786650.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSNT_RS00195 (HPSNT_00180) comB7 37128..37241 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPSNT_RS00200 (HPSNT_00185) comB8 37238..37981 (+) 744 WP_001208407.1 type IV secretion system protein Machinery gene
  HPSNT_RS00205 (HPSNT_00190) comB9 37981..38952 (+) 972 WP_014536647.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSNT_RS00210 (HPSNT_00195) comB10 38945..40075 (+) 1131 WP_001045863.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSNT_RS00215 (HPSNT_00200) - 40145..41557 (+) 1413 WP_000694844.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=47020 HPSNT_RS00195 WP_001217873.1 37128..37241(+) (comB7) [Helicobacter pylori SNT49]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=47020 HPSNT_RS00195 WP_001217873.1 37128..37241(+) (comB7) [Helicobacter pylori SNT49]
ATGAGAATTTTTTTTGTTATCATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment