Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   H0S62_RS11410 Genome accession   NZ_CP059386
Coordinates   2294292..2294618 (+) Length   108 a.a.
NCBI ID   WP_002126519.1    Uniprot ID   -
Organism   Acinetobacter baumannii strain 36-1512     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2229457..2300791 2294292..2294618 within 0


Gene organization within MGE regions


Location: 2229457..2300791
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H0S62_RS11095 (H0S62_11095) - 2229725..2230219 (+) 495 WP_001003818.1 IS630 family transposase -
  H0S62_RS11100 (H0S62_11100) - 2230223..2230870 (-) 648 Protein_2134 hypothetical protein -
  H0S62_RS11105 (H0S62_11105) - 2230863..2232488 (-) 1626 WP_000834616.1 NAD+ synthase -
  H0S62_RS11110 (H0S62_11110) - 2232873..2233433 (-) 561 WP_001048355.1 hypothetical protein -
  H0S62_RS11115 (H0S62_11115) - 2233524..2234384 (-) 861 WP_002059770.1 pirin family protein -
  H0S62_RS11120 (H0S62_11120) hemJ 2234555..2235007 (-) 453 WP_000339889.1 protoporphyrinogen oxidase HemJ -
  H0S62_RS11125 (H0S62_11125) - 2235026..2236255 (-) 1230 WP_000832710.1 beta-ketoacyl-ACP synthase II -
  H0S62_RS11130 (H0S62_11130) - 2236552..2237877 (+) 1326 WP_000160010.1 EcsC family protein -
  H0S62_RS11135 (H0S62_11135) rpsL 2238078..2238452 (+) 375 WP_000246374.1 30S ribosomal protein S12 -
  H0S62_RS11140 (H0S62_11140) rpsG 2238612..2239082 (+) 471 WP_001138055.1 30S ribosomal protein S7 -
  H0S62_RS11145 (H0S62_11145) fusA 2239261..2241399 (+) 2139 WP_000113824.1 elongation factor G -
  H0S62_RS11150 (H0S62_11150) tuf 2241494..2242684 (+) 1191 WP_001029610.1 elongation factor Tu -
  H0S62_RS11155 (H0S62_11155) - 2242888..2243769 (+) 882 WP_002058580.1 metal-dependent hydrolase -
  H0S62_RS11160 (H0S62_11160) - 2244011..2244886 (+) 876 WP_016654330.1 metal-dependent hydrolase -
  H0S62_RS11165 (H0S62_11165) rimI 2244994..2245449 (+) 456 WP_002058576.1 ribosomal protein S18-alanine N-acetyltransferase -
  H0S62_RS11170 (H0S62_11170) - 2245494..2246309 (-) 816 WP_000844343.1 arginyltransferase -
  H0S62_RS11175 (H0S62_11175) aat 2246328..2247059 (-) 732 WP_002058572.1 leucyl/phenylalanyl-tRNA--protein transferase -
  H0S62_RS11180 (H0S62_11180) trxB 2247179..2248126 (-) 948 WP_001276144.1 thioredoxin-disulfide reductase -
  H0S62_RS11185 (H0S62_11185) - 2248396..2251428 (+) 3033 WP_002058569.1 DNA translocase FtsK -
  H0S62_RS11190 (H0S62_11190) rhtC 2251578..2252198 (+) 621 WP_000959256.1 threonine export protein RhtC -
  H0S62_RS11195 (H0S62_11195) - 2252241..2252528 (-) 288 WP_001218560.1 PA4642 family protein -
  H0S62_RS11200 (H0S62_11200) minE 2252612..2252884 (-) 273 WP_000896934.1 cell division topological specificity factor MinE -
  H0S62_RS11205 (H0S62_11205) minD 2252887..2253699 (-) 813 WP_001074362.1 septum site-determining protein MinD -
  H0S62_RS11210 (H0S62_11210) minC 2253770..2254492 (-) 723 WP_000763675.1 septum site-determining protein MinC -
  H0S62_RS11215 (H0S62_11215) - 2254614..2255660 (-) 1047 WP_002058587.1 hypothetical protein -
  H0S62_RS11220 (H0S62_11220) - 2255677..2256603 (-) 927 WP_000100975.1 acyltransferase -
  H0S62_RS11225 (H0S62_11225) - 2256848..2257501 (+) 654 WP_032023189.1 OmpA family protein -
  H0S62_RS11230 (H0S62_11230) rep 2257695..2259734 (+) 2040 WP_000093035.1 DNA helicase Rep -
  H0S62_RS11235 (H0S62_11235) dut 2259759..2260211 (+) 453 WP_000868152.1 dUTP diphosphatase -
  H0S62_RS11240 (H0S62_11240) - 2260411..2261829 (+) 1419 WP_001102831.1 phosphomannomutase/phosphoglucomutase -
  H0S62_RS11245 (H0S62_11245) argB 2261844..2262752 (+) 909 WP_001135419.1 acetylglutamate kinase -
  H0S62_RS11250 (H0S62_11250) - 2262873..2263655 (+) 783 WP_000890282.1 GNAT family N-acetyltransferase -
  H0S62_RS11255 (H0S62_11255) - 2263764..2264612 (+) 849 WP_000336554.1 class II glutamine amidotransferase -
  H0S62_RS11260 (H0S62_11260) - 2264865..2265320 (+) 456 WP_000782976.1 bacteriohemerythrin -
  H0S62_RS11265 (H0S62_11265) - 2265473..2266540 (+) 1068 WP_004835750.1 hypothetical protein -
  H0S62_RS11270 (H0S62_11270) - 2266540..2266863 (+) 324 WP_000442589.1 RnfH family protein -
  H0S62_RS11275 (H0S62_11275) - 2266918..2267316 (-) 399 WP_001170994.1 outer membrane protein assembly factor BamE -
  H0S62_RS11280 (H0S62_11280) fur 2267428..2267865 (+) 438 WP_001122847.1 ferric iron uptake transcriptional regulator -
  H0S62_RS11285 (H0S62_11285) pilU 2267935..2269053 (-) 1119 WP_000347036.1 PilT/PilU family type 4a pilus ATPase Machinery gene
  H0S62_RS11290 (H0S62_11290) pilT 2269081..2270118 (-) 1038 WP_000355489.1 type IV pilus twitching motility protein PilT Machinery gene
  H0S62_RS11295 (H0S62_11295) - 2270245..2270937 (+) 693 WP_001108520.1 YggS family pyridoxal phosphate-dependent enzyme -
  H0S62_RS11300 (H0S62_11300) - 2271139..2274735 (-) 3597 WP_002058592.1 AAA family ATPase -
  H0S62_RS11305 (H0S62_11305) - 2274745..2276013 (-) 1269 WP_181631102.1 exonuclease SbcCD subunit D -
  H0S62_RS11310 (H0S62_11310) - 2276178..2276651 (+) 474 WP_000152331.1 OsmC family protein -
  H0S62_RS11315 (H0S62_11315) - 2276723..2277100 (-) 378 WP_001059432.1 VOC family protein -
  H0S62_RS11320 (H0S62_11320) - 2277481..2277933 (+) 453 WP_000161637.1 ABZJ_00895 family protein -
  H0S62_RS11325 (H0S62_11325) - 2278021..2278926 (+) 906 WP_001039368.1 TIGR01777 family oxidoreductase -
  H0S62_RS11330 (H0S62_11330) - 2278918..2280033 (-) 1116 WP_000546680.1 NAD(P)/FAD-dependent oxidoreductase -
  H0S62_RS11335 (H0S62_11335) hemB 2280059..2281072 (-) 1014 WP_000222569.1 porphobilinogen synthase -
  H0S62_RS11340 (H0S62_11340) - 2281215..2281712 (+) 498 WP_002156418.1 thioesterase family protein -
  H0S62_RS11345 (H0S62_11345) - 2281982..2283133 (+) 1152 WP_000128703.1 EmrA/EmrK family multidrug efflux transporter periplasmic adaptor subunit -
  H0S62_RS11350 (H0S62_11350) - 2283140..2284663 (+) 1524 WP_000857095.1 DHA2 family efflux MFS transporter permease subunit -
  H0S62_RS11355 (H0S62_11355) ggt 2284967..2286952 (+) 1986 WP_002058570.1 gamma-glutamyltransferase -
  H0S62_RS11365 (H0S62_11365) - 2287652..2288881 (+) 1230 WP_101433600.1 tyrosine-type recombinase/integrase -
  H0S62_RS11370 (H0S62_11370) - 2289033..2289872 (+) 840 WP_031980813.1 hypothetical protein -
  H0S62_RS11375 (H0S62_11375) - 2290027..2290242 (+) 216 WP_002124843.1 hypothetical protein -
  H0S62_RS11380 (H0S62_11380) - 2290246..2290464 (+) 219 WP_002124817.1 helix-turn-helix domain-containing protein -
  H0S62_RS11385 (H0S62_11385) - 2290461..2290967 (+) 507 WP_101433601.1 Bro-N domain-containing protein -
  H0S62_RS11390 (H0S62_11390) - 2290960..2291328 (+) 369 WP_101433602.1 hypothetical protein -
  H0S62_RS11395 (H0S62_11395) - 2291338..2291649 (+) 312 WP_000787400.1 hypothetical protein -
  H0S62_RS11400 (H0S62_11400) - 2291642..2291938 (+) 297 WP_101433603.1 hypothetical protein -
  H0S62_RS11405 (H0S62_11405) - 2291935..2294052 (+) 2118 WP_228156526.1 DUF3987 domain-containing protein -
  H0S62_RS11410 (H0S62_11410) ssb 2294292..2294618 (+) 327 WP_002126519.1 single-stranded DNA-binding protein Machinery gene
  H0S62_RS11415 (H0S62_11415) - 2297380..2297811 (+) 432 WP_005129415.1 hypothetical protein -
  H0S62_RS11420 (H0S62_11420) - 2297922..2298110 (+) 189 WP_017725301.1 hypothetical protein -
  H0S62_RS11425 (H0S62_11425) - 2298083..2298673 (+) 591 WP_238615509.1 ImmA/IrrE family metallo-endopeptidase -
  H0S62_RS11430 (H0S62_11430) - 2298839..2299123 (-) 285 WP_032023362.1 hypothetical protein -
  H0S62_RS11435 (H0S62_11435) - 2299276..2300208 (-) 933 WP_002122868.1 IS5 family transposase -

Sequence


Protein


Download         Length: 108 a.a.        Molecular weight: 12234.94 Da        Isoelectric Point: 10.2394

>NTDB_id=469266 H0S62_RS11410 WP_002126519.1 2294292..2294618(+) (ssb) [Acinetobacter baumannii strain 36-1512]
MPNVNKVTVMGVLGRDPETKQFPNGGSVTTFSVATTEFWKDKTTGERKEATEWHRITTSNRLAEIASKYLKKGGKVYIEG
SLRTRKWKDSKGAEKEITEIRADEMQLL

Nucleotide


Download         Length: 327 bp        

>NTDB_id=469266 H0S62_RS11410 WP_002126519.1 2294292..2294618(+) (ssb) [Acinetobacter baumannii strain 36-1512]
ATGCCAAACGTAAACAAAGTAACTGTGATGGGTGTACTAGGTCGTGACCCTGAAACTAAACAATTTCCCAACGGCGGAAG
CGTTACCACATTCAGCGTTGCAACTACTGAGTTTTGGAAAGACAAGACTACAGGCGAGCGTAAAGAAGCTACAGAGTGGC
ATAGAATCACCACCAGCAACCGATTAGCCGAGATTGCCAGTAAGTACCTCAAGAAAGGCGGAAAGGTGTATATCGAAGGC
TCATTGCGTACAAGGAAGTGGAAGGACAGCAAAGGGGCGGAAAAGGAAATAACCGAGATTCGAGCAGATGAGATGCAATT
GCTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

55.556

100

0.556

  ssb Neisseria gonorrhoeae MS11

51.887

98.148

0.509

  ssb Neisseria meningitidis MC58

51.887

98.148

0.509

  ssb Vibrio cholerae strain A1552

54.639

89.815

0.491