Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPF32_RS06595 Genome accession   NC_017366
Coordinates   1348469..1348594 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori F32     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 1343469..1353594
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPF32_RS06575 (HPF32_1274) - 1344153..1345565 (-) 1413 WP_000694854.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPF32_RS06580 (HPF32_1275) comB10 1345635..1346771 (-) 1137 WP_001045742.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPF32_RS06585 (HPF32_1276) comB9 1346764..1347729 (-) 966 WP_014535464.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPF32_RS06590 (HPF32_1277) comB8 1347729..1348472 (-) 744 WP_000660529.1 type IV secretion system protein Machinery gene
  HPF32_RS06595 comB7 1348469..1348594 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPF32_RS06600 (HPF32_1278) comB6 1348610..1349665 (-) 1056 WP_000786683.1 P-type conjugative transfer protein TrbL Machinery gene
  HPF32_RS06605 (HPF32_1279) - 1349671..1350666 (-) 996 WP_000902474.1 PDZ domain-containing protein -
  HPF32_RS06610 (HPF32_1280) - 1350666..1350959 (-) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  HPF32_RS06615 (HPF32_1281) panD 1350962..1351315 (-) 354 WP_000142245.1 aspartate 1-decarboxylase -
  HPF32_RS06620 (HPF32_1282) - 1351305..1353530 (-) 2226 WP_001051519.1 AAA family ATPase -

Sequence


Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=46882 HPF32_RS06595 WP_001217874.1 1348469..1348594(-) (comB7) [Helicobacter pylori F32]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=46882 HPF32_RS06595 WP_001217874.1 1348469..1348594(-) (comB7) [Helicobacter pylori F32]
ATGAGAATTTTTTTTGTTATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTGAATCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878


Multiple sequence alignment