Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPSA_RS00205 Genome accession   NC_017361
Coordinates   38105..38218 (+) Length   37 a.a.
NCBI ID   WP_001217877.1    Uniprot ID   A0A1A9H2U2
Organism   Helicobacter pylori SouthAfrica7     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 33105..43218
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSA_RS00180 (HPSA_00155) - 33158..35380 (+) 2223 WP_000357230.1 AAA family ATPase -
  HPSA_RS00185 (HPSA_00160) panD 35370..35720 (+) 351 WP_000142294.1 aspartate 1-decarboxylase -
  HPSA_RS00190 (HPSA_00165) - 35731..36024 (+) 294 WP_000347932.1 YbaB/EbfC family nucleoid-associated protein -
  HPSA_RS00195 (HPSA_00170) - 36024..37019 (+) 996 WP_000468493.1 PDZ domain-containing protein -
  HPSA_RS00200 (HPSA_00175) comB6 37025..38089 (+) 1065 WP_014534702.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSA_RS00205 (HPSA_00180) comB7 38105..38218 (+) 114 WP_001217877.1 hypothetical protein Machinery gene
  HPSA_RS00210 (HPSA_00185) comB8 38215..38958 (+) 744 WP_000660575.1 type IV secretion system protein Machinery gene
  HPSA_RS00215 (HPSA_00190) comB9 38958..39938 (+) 981 WP_001213934.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSA_RS00220 (HPSA_00195) comB10 39931..41073 (+) 1143 WP_001045896.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSA_RS00225 (HPSA_00200) - 41138..42550 (+) 1413 WP_000693966.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4291.23 Da        Isoelectric Point: 9.3572

>NTDB_id=46807 HPSA_RS00205 WP_001217877.1 38105..38218(+) (comB7) [Helicobacter pylori SouthAfrica7]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=46807 HPSA_RS00205 WP_001217877.1 38105..38218(+) (comB7) [Helicobacter pylori SouthAfrica7]
ATGAGAATCTTTTTTGTTATTATGGGACTTGTGTTGTTTGGTTGCACGAGCAAGGTGCATGAAATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAACCTTGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A1A9H2U2

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

97.297

100

0.973


Multiple sequence alignment