Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPSAT_RS00190 Genome accession   NC_017359
Coordinates   33539..33652 (+) Length   37 a.a.
NCBI ID   WP_001218100.1    Uniprot ID   -
Organism   Helicobacter pylori Sat464     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 28539..38652
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPSAT_RS00165 (HPSAT_00165) - 28590..30812 (+) 2223 WP_001051541.1 AAA family ATPase -
  HPSAT_RS00170 (HPSAT_00170) panD 30802..31152 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HPSAT_RS00175 (HPSAT_00175) - 31163..31465 (+) 303 WP_000347918.1 YbaB/EbfC family nucleoid-associated protein -
  HPSAT_RS00180 (HPSAT_00180) - 31465..32460 (+) 996 WP_000468448.1 PDZ domain-containing protein -
  HPSAT_RS00185 (HPSAT_00185) comB6 32468..33523 (+) 1056 WP_000786689.1 P-type conjugative transfer protein TrbL Machinery gene
  HPSAT_RS00190 (HPSAT_00190) comB7 33539..33652 (+) 114 WP_001218100.1 hypothetical protein Machinery gene
  HPSAT_RS00195 (HPSAT_00195) comB8 33649..34392 (+) 744 WP_000660544.1 type IV secretion system protein Machinery gene
  HPSAT_RS00200 (HPSAT_00200) comB9 34392..35357 (+) 966 WP_012443264.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPSAT_RS00205 (HPSAT_00205) comB10 35350..36486 (+) 1137 WP_001045867.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPSAT_RS00210 (HPSAT_00210) - 36556..37968 (+) 1413 WP_000694832.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4263.19 Da        Isoelectric Point: 9.3572

>NTDB_id=46766 HPSAT_RS00190 WP_001218100.1 33539..33652(+) (comB7) [Helicobacter pylori Sat464]
MRIFSVIMGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=46766 HPSAT_RS00190 WP_001218100.1 33539..33652(+) (comB7) [Helicobacter pylori Sat464]
ATGAGAATTTTTTCTGTCATTATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

89.189

100

0.892

Multiple sequence alignment