Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HPKB_RS06505 Genome accession   NC_017354
Coordinates   1335770..1335895 (-) Length   41 a.a.
NCBI ID   WP_001217874.1    Uniprot ID   A0AAI7ZWZ6
Organism   Helicobacter pylori 52     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1330770..1340895
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPKB_RS06485 (HPKB_1280) - 1331463..1332875 (-) 1413 WP_000694850.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HPKB_RS06490 (HPKB_1281) comB10 1332945..1334081 (-) 1137 WP_001045779.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPKB_RS06495 (HPKB_1282) comB9 1334074..1335036 (-) 963 WP_014533534.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPKB_RS06500 (HPKB_1283) comB8 1335036..1335773 (-) 738 WP_000660526.1 type IV secretion system protein Machinery gene
  HPKB_RS06505 (HPKB_1284) comB7 1335770..1335895 (-) 126 WP_001217874.1 hypothetical protein Machinery gene
  HPKB_RS06510 (HPKB_1285) comB6 1335911..1336966 (-) 1056 WP_000786672.1 P-type conjugative transfer protein TrbL Machinery gene
  HPKB_RS06515 (HPKB_1286) - 1336974..1337969 (-) 996 WP_000468447.1 PDZ domain-containing protein -
  HPKB_RS06520 (HPKB_1287) - 1337969..1338262 (-) 294 WP_000347922.1 YbaB/EbfC family nucleoid-associated protein -
  HPKB_RS06525 (HPKB_1288) panD 1338273..1338623 (-) 351 WP_000142205.1 aspartate 1-decarboxylase -
  HPKB_RS06530 (HPKB_1289) - 1338613..1340838 (-) 2226 WP_001051539.1 AAA family ATPase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4798.82 Da        Isoelectric Point: 9.3278

>NTDB_id=46717 HPKB_RS06505 WP_001217874.1 1335770..1335895(-) (comB7) [Helicobacter pylori 52]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENRLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=46717 HPKB_RS06505 WP_001217874.1 1335770..1335895(-) (comB7) [Helicobacter pylori 52]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACAGGTTAAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

87.805

100

0.878

Multiple sequence alignment