Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   MS7_RS03220 Genome accession   NC_017351
Coordinates   653051..653521 (+) Length   156 a.a.
NCBI ID   WP_000934800.1    Uniprot ID   -
Organism   Staphylococcus aureus subsp. aureus 11819-97     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 643674..686827 653051..653521 within 0


Gene organization within MGE regions


Location: 643674..686827
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MS7_RS03150 (MS7_0584) - 643674..645050 (-) 1377 WP_000861314.1 recombinase family protein -
  MS7_RS03155 (MS7_0585) - 645257..645937 (-) 681 WP_000392109.1 type II toxin-antitoxin system PemK/MazF family toxin -
  MS7_RS03160 (MS7_0586) - 645973..646692 (-) 720 WP_000358224.1 XRE family transcriptional regulator -
  MS7_RS03165 (MS7_0587) - 646834..647052 (+) 219 WP_001198672.1 helix-turn-helix transcriptional regulator -
  MS7_RS03170 (MS7_0588) - 647068..647856 (+) 789 WP_001148566.1 phage antirepressor KilAC domain-containing protein -
  MS7_RS03175 (MS7_0589) - 647873..648067 (+) 195 WP_000390105.1 hypothetical protein -
  MS7_RS03180 - 648120..648323 (+) 204 Protein_589 hypothetical protein -
  MS7_RS03185 (MS7_0590) - 648291..648536 (-) 246 WP_000122246.1 hypothetical protein -
  MS7_RS03190 (MS7_0591) - 648690..648851 (+) 162 WP_000066020.1 DUF1270 domain-containing protein -
  MS7_RS03195 (MS7_0592) - 648946..649206 (+) 261 WP_000291489.1 DUF1108 family protein -
  MS7_RS03200 - 649215..649478 (+) 264 WP_001205732.1 hypothetical protein -
  MS7_RS03205 (MS7_0593) - 649487..651430 (+) 1944 WP_000700527.1 AAA family ATPase -
  MS7_RS03210 (MS7_0594) - 651432..652352 (+) 921 WP_000138475.1 recombinase RecT -
  MS7_RS03215 (MS7_0595) - 652433..653050 (+) 618 WP_072528355.1 MBL fold metallo-hydrolase -
  MS7_RS03220 (MS7_0596) ssbA 653051..653521 (+) 471 WP_000934800.1 single-stranded DNA-binding protein Machinery gene
  MS7_RS03225 - 653551..654435 (+) 885 WP_000148312.1 DnaD domain protein -
  MS7_RS03230 (MS7_0598) - 654442..654660 (+) 219 WP_000338528.1 hypothetical protein -
  MS7_RS03235 (MS7_0599) - 654669..655073 (+) 405 WP_000401972.1 RusA family crossover junction endodeoxyribonuclease -
  MS7_RS03240 (MS7_0600) - 655086..655457 (+) 372 WP_001140278.1 SA1788 family PVL leukocidin-associated protein -
  MS7_RS03245 (MS7_0601) - 655458..655706 (+) 249 WP_001126832.1 phi PVL orf 51-like protein -
  MS7_RS03250 (MS7_0602) - 655719..656120 (+) 402 WP_000695766.1 hypothetical protein -
  MS7_RS03255 (MS7_0603) - 656117..656482 (+) 366 WP_001105616.1 hypothetical protein -
  MS7_RS03260 (MS7_0604) - 656508..656729 (+) 222 WP_237708946.1 DUF1024 family protein -
  MS7_RS03265 (MS7_0605) - 656716..656886 (+) 171 WP_000714407.1 hypothetical protein -
  MS7_RS03270 (MS7_0606) - 656879..657415 (+) 537 WP_001066452.1 dUTPase -
  MS7_RS03275 (MS7_0607) - 657452..657658 (+) 207 WP_000195779.1 DUF1381 domain-containing protein -
  MS7_RS03280 (MS7_0608) - 657655..657849 (+) 195 WP_000132920.1 hypothetical protein -
  MS7_RS03285 (MS7_0609) - 657846..658049 (+) 204 WP_001072795.1 hypothetical protein -
  MS7_RS03290 (MS7_0610) - 658042..658278 (+) 237 WP_000608273.1 hypothetical protein -
  MS7_RS03295 (MS7_0611) - 658271..658657 (+) 387 WP_000592236.1 hypothetical protein -
  MS7_RS03300 (MS7_0612) - 658654..658827 (+) 174 WP_000595278.1 transcriptional activator RinB -
  MS7_RS03305 (MS7_0613) - 658828..659193 (+) 366 WP_000455357.1 hypothetical protein -
  MS7_RS03310 (MS7_0614) - 659194..659340 (+) 147 WP_000990005.1 hypothetical protein -
  MS7_RS03315 (MS7_0615) - 659364..659786 (+) 423 WP_000162696.1 RinA family phage transcriptional activator -
  MS7_RS03320 (MS7_0616) - 659973..660413 (+) 441 WP_001003272.1 terminase small subunit -
  MS7_RS03325 (MS7_0617) - 660400..661677 (+) 1278 WP_000169946.1 PBSX family phage terminase large subunit -
  MS7_RS03330 (MS7_0618) - 661688..663226 (+) 1539 WP_000921875.1 phage portal protein -
  MS7_RS03335 (MS7_0619) - 663233..664228 (+) 996 WP_001668926.1 minor capsid protein -
  MS7_RS03340 (MS7_0620) - 664301..664471 (+) 171 WP_000072202.1 hypothetical protein -
  MS7_RS15640 - 664499..664592 (+) 94 Protein_622 hypothetical protein -
  MS7_RS03345 (MS7_0621) - 664580..665200 (+) 621 WP_000392143.1 DUF4355 domain-containing protein -
  MS7_RS03350 (MS7_0622) - 665214..666188 (+) 975 WP_000438513.1 phage major capsid protein -
  MS7_RS03355 (MS7_0623) - 666210..666497 (+) 288 WP_001114085.1 hypothetical protein -
  MS7_RS03360 (MS7_0624) - 666506..666838 (+) 333 WP_000208960.1 phage head-tail connector protein -
  MS7_RS03365 - 666835..667137 (+) 303 WP_001268313.1 hypothetical protein -
  MS7_RS03370 (MS7_0625) - 667137..667484 (+) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  MS7_RS03375 (MS7_0626) - 667496..667879 (+) 384 WP_000188649.1 hypothetical protein -
  MS7_RS03380 (MS7_0627) - 667898..668479 (+) 582 WP_000002578.1 phage major tail protein, TP901-1 family -
  MS7_RS03385 (MS7_0628) - 668542..668907 (+) 366 WP_001100163.1 tail assembly chaperone -
  MS7_RS03390 (MS7_0629) - 668937..669281 (+) 345 WP_000105584.1 hypothetical protein -
  MS7_RS03395 (MS7_0630) - 669298..672762 (+) 3465 WP_000141466.1 hypothetical protein -
  MS7_RS03400 (MS7_0631) - 672775..673722 (+) 948 WP_000350680.1 phage tail family protein -
  MS7_RS03405 (MS7_0632) - 673731..675632 (+) 1902 WP_000152714.1 SGNH/GDSL hydrolase family protein -
  MS7_RS03410 (MS7_0633) - 675647..677557 (+) 1911 WP_000369012.1 hypothetical protein -
  MS7_RS03415 (MS7_0634) - 677557..679380 (+) 1824 WP_000259632.1 BppU family phage baseplate upper protein -
  MS7_RS03420 (MS7_0635) - 679380..679757 (+) 378 WP_000705896.1 DUF2977 domain-containing protein -
  MS7_RS03425 (MS7_0636) - 679761..679934 (+) 174 WP_000782200.1 XkdX family protein -
  MS7_RS03430 (MS7_0637) - 679974..680273 (+) 300 WP_000466778.1 DUF2951 domain-containing protein -
  MS7_RS03435 (MS7_0638) - 680410..682308 (+) 1899 WP_000524022.1 glucosaminidase domain-containing protein -
  MS7_RS03440 (MS7_0639) - 682321..683559 (+) 1239 WP_000276650.1 BppU family phage baseplate upper protein -
  MS7_RS03445 (MS7_0640) - 683564..683959 (+) 396 WP_000387943.1 hypothetical protein -
  MS7_RS03450 (MS7_0641) - 684014..684451 (+) 438 WP_000354128.1 phage holin -
  MS7_RS03455 (MS7_0642) - 684432..685877 (+) 1446 WP_001148134.1 SH3 domain-containing protein -
  MS7_RS03460 (MS7_0643) - 686406..686612 (+) 207 WP_000125171.1 hypothetical protein -
  MS7_RS03465 (MS7_0644) - 686627..686827 (+) 201 WP_000498229.1 hypothetical protein -

Sequence


Protein


Download         Length: 156 a.a.        Molecular weight: 17668.41 Da        Isoelectric Point: 4.6228

>NTDB_id=46631 MS7_RS03220 WP_000934800.1 653051..653521(+) (ssbA) [Staphylococcus aureus subsp. aureus 11819-97]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSR
NYENQEGRRVFVTEVVCDSVQFLEPKNTNDSQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=46631 MS7_RS03220 WP_000934800.1 653051..653521(+) (ssbA) [Staphylococcus aureus subsp. aureus 11819-97]
ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACTCCTTCAGGTGTGAGTGTAGC
GACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCTCAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTT
TTAGAAGACAAGCAGATAATGTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTTCAATTTTTAGAACCAAAGAA
CACAAATGACTCTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.582

100

0.699

  ssb Latilactobacillus sakei subsp. sakei 23K

52.941

100

0.577

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

67.949

0.397

  ssb Glaesserella parasuis strain SC1401

32.768

100

0.372


Multiple sequence alignment