Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HZT25_RS06595 | Genome accession | NZ_CP058886 |
| Coordinates | 1360196..1360711 (-) | Length | 171 a.a. |
| NCBI ID | WP_000168264.1 | Uniprot ID | A0A7L5X6G7 |
| Organism | Shigella flexneri strain STLEFF_33 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1354974..1396187 | 1360196..1360711 | within | 0 |
Gene organization within MGE regions
Location: 1354974..1396187
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT25_RS06540 (HZT25_06515) | dsdC | 1354974..1355909 (+) | 936 | WP_001300996.1 | DNA-binding transcriptional regulator DsdC | - |
| HZT25_RS06545 (HZT25_06520) | torI | 1356093..1356293 (-) | 201 | WP_001163428.1 | response regulator inhibitor TorI | - |
| HZT25_RS06550 (HZT25_06525) | - | 1356402..1356701 (-) | 300 | WP_001447403.1 | hypothetical protein | - |
| HZT25_RS06555 (HZT25_06530) | - | 1356859..1357137 (-) | 279 | WP_001388117.1 | DUF4752 family protein | - |
| HZT25_RS06560 (HZT25_06535) | - | 1357137..1357754 (-) | 618 | WP_240763776.1 | DUF551 domain-containing protein | - |
| HZT25_RS06565 (HZT25_06540) | - | 1357751..1358266 (-) | 516 | WP_240763778.1 | hypothetical protein | - |
| HZT25_RS06570 (HZT25_06545) | - | 1358271..1358891 (-) | 621 | WP_240763780.1 | ead/Ea22-like family protein | - |
| HZT25_RS06575 (HZT25_06550) | - | 1358888..1359250 (-) | 363 | WP_240763782.1 | hypothetical protein | - |
| HZT25_RS06580 (HZT25_06555) | - | 1359247..1359714 (-) | 468 | WP_240763783.1 | hypothetical protein | - |
| HZT25_RS06585 (HZT25_06560) | - | 1359711..1359875 (-) | 165 | WP_001214456.1 | DUF2737 family protein | - |
| HZT25_RS06590 (HZT25_06565) | - | 1359886..1360182 (-) | 297 | WP_001111285.1 | phage anti-RecBCD protein | - |
| HZT25_RS06595 (HZT25_06570) | ssb | 1360196..1360711 (-) | 516 | WP_000168264.1 | single-stranded DNA-binding protein | Machinery gene |
| HZT25_RS06600 (HZT25_06575) | - | 1360712..1361419 (-) | 708 | WP_001296878.1 | Rad52/Rad22 family DNA repair protein | - |
| HZT25_RS06605 (HZT25_06580) | - | 1361428..1361598 (-) | 171 | WP_000050554.1 | hypothetical protein | - |
| HZT25_RS06610 (HZT25_06585) | kil | 1361674..1361826 (-) | 153 | WP_001243355.1 | host cell division inhibitory peptide Kil | - |
| HZT25_RS06615 (HZT25_06590) | - | 1361811..1361942 (-) | 132 | WP_032174193.1 | protease FtsH-inhibitory lysogeny factor CIII | - |
| HZT25_RS06620 (HZT25_06595) | - | 1361967..1362935 (-) | 969 | WP_240763784.1 | cell envelope biogenesis protein TolA | - |
| HZT25_RS06625 (HZT25_06600) | - | 1363070..1363258 (-) | 189 | WP_000865175.1 | hypothetical protein | - |
| HZT25_RS06630 (HZT25_06605) | - | 1363258..1363554 (-) | 297 | WP_000394578.1 | hypothetical protein | - |
| HZT25_RS06635 (HZT25_06610) | - | 1363594..1363845 (-) | 252 | WP_000394305.1 | hypothetical protein | - |
| HZT25_RS06640 (HZT25_06615) | - | 1363854..1364159 (-) | 306 | WP_240763785.1 | regulator | - |
| HZT25_RS06645 (HZT25_06620) | - | 1364474..1365124 (-) | 651 | WP_001095982.1 | LexA family transcriptional regulator | - |
| HZT25_RS06650 (HZT25_06625) | - | 1365205..1365390 (+) | 186 | WP_000276885.1 | Cro/CI family transcriptional regulator | - |
| HZT25_RS06655 (HZT25_06630) | - | 1365506..1365802 (+) | 297 | WP_000035948.1 | CII family transcriptional regulator | - |
| HZT25_RS06660 (HZT25_06635) | - | 1365835..1365996 (+) | 162 | WP_000166961.1 | hypothetical protein | - |
| HZT25_RS06665 (HZT25_06640) | - | 1365983..1366804 (+) | 822 | WP_001608293.1 | replication protein | - |
| HZT25_RS06670 (HZT25_06645) | - | 1366801..1368177 (+) | 1377 | WP_240763787.1 | replicative DNA helicase | - |
| HZT25_RS06675 (HZT25_06650) | - | 1368252..1368692 (+) | 441 | WP_000736913.1 | recombination protein NinB | - |
| HZT25_RS06680 (HZT25_06655) | - | 1368689..1369216 (+) | 528 | WP_000153259.1 | phage N-6-adenine-methyltransferase | - |
| HZT25_RS06685 (HZT25_06660) | - | 1369213..1369389 (+) | 177 | WP_001254255.1 | NinE family protein | - |
| HZT25_RS06690 (HZT25_06665) | - | 1369392..1369754 (+) | 363 | WP_062810255.1 | phage protein NinX family protein | - |
| HZT25_RS06695 (HZT25_06670) | - | 1369747..1369923 (+) | 177 | WP_000950963.1 | protein NinF | - |
| HZT25_RS06700 (HZT25_06675) | - | 1369916..1370521 (+) | 606 | WP_062810254.1 | recombination protein NinG | - |
| HZT25_RS06705 (HZT25_06680) | - | 1370518..1371183 (+) | 666 | WP_062810253.1 | serine/threonine protein phosphatase | - |
| HZT25_RS06710 (HZT25_06685) | - | 1371180..1371803 (+) | 624 | WP_001235459.1 | antitermination protein | - |
| HZT25_RS06715 (HZT25_06690) | - | 1372480..1372803 (+) | 324 | WP_000783734.1 | phage holin, lambda family | - |
| HZT25_RS06720 (HZT25_06695) | - | 1372787..1373263 (+) | 477 | WP_000229392.1 | glycoside hydrolase family protein | - |
| HZT25_RS06725 (HZT25_06700) | - | 1373260..1373697 (+) | 438 | WP_240763789.1 | lysis protein | - |
| HZT25_RS06730 (HZT25_06705) | - | 1373847..1374452 (+) | 606 | WP_021528610.1 | Rha family transcriptional regulator | - |
| HZT25_RS06735 (HZT25_06710) | - | 1374680..1374922 (+) | 243 | WP_000807789.1 | DUF2560 family protein | - |
| HZT25_RS06740 (HZT25_06715) | - | 1374926..1375213 (+) | 288 | WP_137546504.1 | hypothetical protein | - |
| HZT25_RS06745 (HZT25_06720) | - | 1375223..1375402 (+) | 180 | WP_240763791.1 | hypothetical protein | - |
| HZT25_RS06750 (HZT25_06725) | - | 1375426..1375914 (+) | 489 | WP_000729920.1 | DNA-packaging protein | - |
| HZT25_RS06755 (HZT25_06730) | - | 1375892..1377391 (+) | 1500 | WP_000417850.1 | terminase family protein | - |
| HZT25_RS06760 (HZT25_06735) | - | 1377392..1379557 (+) | 2166 | WP_062810285.1 | portal protein | - |
| HZT25_RS06765 (HZT25_06740) | - | 1379571..1380482 (+) | 912 | WP_000373006.1 | scaffold protein | - |
| HZT25_RS06770 (HZT25_06745) | - | 1380482..1381777 (+) | 1296 | WP_233331110.1 | P22 phage major capsid protein family protein | - |
| HZT25_RS06775 (HZT25_06750) | - | 1381822..1382082 (+) | 261 | WP_023277605.1 | hypothetical protein | - |
| HZT25_RS06780 (HZT25_06755) | - | 1382060..1382560 (+) | 501 | WP_219388981.1 | packaged DNA stabilization gp4 family protein | - |
| HZT25_RS06785 (HZT25_06760) | - | 1382561..1383979 (+) | 1419 | WP_233331111.1 | packaged DNA stabilization protein gp10 | - |
| HZT25_RS06790 (HZT25_06765) | - | 1383979..1384932 (+) | 954 | WP_086623956.1 | tail needle knob protein | - |
| HZT25_RS06795 (HZT25_06770) | - | 1384932..1385387 (+) | 456 | WP_086623954.1 | DUF2824 family protein | - |
| HZT25_RS06800 (HZT25_06775) | - | 1385390..1386082 (+) | 693 | WP_045133253.1 | DNA transfer protein | - |
| HZT25_RS06805 (HZT25_06780) | - | 1386093..1387472 (+) | 1380 | WP_233331112.1 | DNA transfer protein | - |
| HZT25_RS06810 (HZT25_06785) | - | 1387472..1389301 (+) | 1830 | WP_233331114.1 | DNA transfer protein | - |
| HZT25_RS06815 (HZT25_06795) | - | 1389664..1390632 (+) | 969 | WP_000136767.1 | P63C domain-containing protein | - |
| HZT25_RS06820 (HZT25_06800) | - | 1390648..1390899 (-) | 252 | WP_103216231.1 | Arc family DNA-binding protein | - |
| HZT25_RS06825 (HZT25_06805) | - | 1391046..1392953 (+) | 1908 | WP_233331113.1 | phage tailspike protein | - |
| HZT25_RS06830 (HZT25_06810) | - | 1393126..1394346 (-) | 1221 | WP_000343760.1 | ISL3-like element ISKox3 family transposase | - |
| HZT25_RS06835 | - | 1394441..1394680 (+) | 240 | WP_103216233.1 | hypothetical protein | - |
| HZT25_RS06840 (HZT25_06815) | - | 1394680..1394997 (+) | 318 | WP_105075735.1 | hypothetical protein | - |
| HZT25_RS06845 (HZT25_06820) | intS | 1395030..1396187 (-) | 1158 | WP_233331122.1 | prophage integrase IntS | - |
Sequence
Protein
Download Length: 171 a.a. Molecular weight: 19154.34 Da Isoelectric Point: 7.4686
>NTDB_id=465835 HZT25_RS06595 WP_000168264.1 1360196..1360711(-) (ssb) [Shigella flexneri strain STLEFF_33]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI
Nucleotide
Download Length: 516 bp
>NTDB_id=465835 HZT25_RS06595 WP_000168264.1 1360196..1360711(-) (ssb) [Shigella flexneri strain STLEFF_33]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAGTATCTGCGGAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGTGGACAGGATCGGTTCACTACCGAAGTTATCGTAGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAGGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATACCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAGTATCTGCGGAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGTGGACAGGATCGGTTCACTACCGAAGTTATCGTAGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAGGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATACCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
62.712 |
100 |
0.649 |
| ssb | Glaesserella parasuis strain SC1401 |
52.486 |
100 |
0.556 |
| ssb | Neisseria gonorrhoeae MS11 |
42.045 |
100 |
0.433 |
| ssb | Neisseria meningitidis MC58 |
41.477 |
100 |
0.427 |