Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HZT25_RS06595 Genome accession   NZ_CP058886
Coordinates   1360196..1360711 (-) Length   171 a.a.
NCBI ID   WP_000168264.1    Uniprot ID   A0A7L5X6G7
Organism   Shigella flexneri strain STLEFF_33     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1354974..1396187 1360196..1360711 within 0


Gene organization within MGE regions


Location: 1354974..1396187
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZT25_RS06540 (HZT25_06515) dsdC 1354974..1355909 (+) 936 WP_001300996.1 DNA-binding transcriptional regulator DsdC -
  HZT25_RS06545 (HZT25_06520) torI 1356093..1356293 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  HZT25_RS06550 (HZT25_06525) - 1356402..1356701 (-) 300 WP_001447403.1 hypothetical protein -
  HZT25_RS06555 (HZT25_06530) - 1356859..1357137 (-) 279 WP_001388117.1 DUF4752 family protein -
  HZT25_RS06560 (HZT25_06535) - 1357137..1357754 (-) 618 WP_240763776.1 DUF551 domain-containing protein -
  HZT25_RS06565 (HZT25_06540) - 1357751..1358266 (-) 516 WP_240763778.1 hypothetical protein -
  HZT25_RS06570 (HZT25_06545) - 1358271..1358891 (-) 621 WP_240763780.1 ead/Ea22-like family protein -
  HZT25_RS06575 (HZT25_06550) - 1358888..1359250 (-) 363 WP_240763782.1 hypothetical protein -
  HZT25_RS06580 (HZT25_06555) - 1359247..1359714 (-) 468 WP_240763783.1 hypothetical protein -
  HZT25_RS06585 (HZT25_06560) - 1359711..1359875 (-) 165 WP_001214456.1 DUF2737 family protein -
  HZT25_RS06590 (HZT25_06565) - 1359886..1360182 (-) 297 WP_001111285.1 phage anti-RecBCD protein -
  HZT25_RS06595 (HZT25_06570) ssb 1360196..1360711 (-) 516 WP_000168264.1 single-stranded DNA-binding protein Machinery gene
  HZT25_RS06600 (HZT25_06575) - 1360712..1361419 (-) 708 WP_001296878.1 Rad52/Rad22 family DNA repair protein -
  HZT25_RS06605 (HZT25_06580) - 1361428..1361598 (-) 171 WP_000050554.1 hypothetical protein -
  HZT25_RS06610 (HZT25_06585) kil 1361674..1361826 (-) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  HZT25_RS06615 (HZT25_06590) - 1361811..1361942 (-) 132 WP_032174193.1 protease FtsH-inhibitory lysogeny factor CIII -
  HZT25_RS06620 (HZT25_06595) - 1361967..1362935 (-) 969 WP_240763784.1 cell envelope biogenesis protein TolA -
  HZT25_RS06625 (HZT25_06600) - 1363070..1363258 (-) 189 WP_000865175.1 hypothetical protein -
  HZT25_RS06630 (HZT25_06605) - 1363258..1363554 (-) 297 WP_000394578.1 hypothetical protein -
  HZT25_RS06635 (HZT25_06610) - 1363594..1363845 (-) 252 WP_000394305.1 hypothetical protein -
  HZT25_RS06640 (HZT25_06615) - 1363854..1364159 (-) 306 WP_240763785.1 regulator -
  HZT25_RS06645 (HZT25_06620) - 1364474..1365124 (-) 651 WP_001095982.1 LexA family transcriptional regulator -
  HZT25_RS06650 (HZT25_06625) - 1365205..1365390 (+) 186 WP_000276885.1 Cro/CI family transcriptional regulator -
  HZT25_RS06655 (HZT25_06630) - 1365506..1365802 (+) 297 WP_000035948.1 CII family transcriptional regulator -
  HZT25_RS06660 (HZT25_06635) - 1365835..1365996 (+) 162 WP_000166961.1 hypothetical protein -
  HZT25_RS06665 (HZT25_06640) - 1365983..1366804 (+) 822 WP_001608293.1 replication protein -
  HZT25_RS06670 (HZT25_06645) - 1366801..1368177 (+) 1377 WP_240763787.1 replicative DNA helicase -
  HZT25_RS06675 (HZT25_06650) - 1368252..1368692 (+) 441 WP_000736913.1 recombination protein NinB -
  HZT25_RS06680 (HZT25_06655) - 1368689..1369216 (+) 528 WP_000153259.1 phage N-6-adenine-methyltransferase -
  HZT25_RS06685 (HZT25_06660) - 1369213..1369389 (+) 177 WP_001254255.1 NinE family protein -
  HZT25_RS06690 (HZT25_06665) - 1369392..1369754 (+) 363 WP_062810255.1 phage protein NinX family protein -
  HZT25_RS06695 (HZT25_06670) - 1369747..1369923 (+) 177 WP_000950963.1 protein NinF -
  HZT25_RS06700 (HZT25_06675) - 1369916..1370521 (+) 606 WP_062810254.1 recombination protein NinG -
  HZT25_RS06705 (HZT25_06680) - 1370518..1371183 (+) 666 WP_062810253.1 serine/threonine protein phosphatase -
  HZT25_RS06710 (HZT25_06685) - 1371180..1371803 (+) 624 WP_001235459.1 antitermination protein -
  HZT25_RS06715 (HZT25_06690) - 1372480..1372803 (+) 324 WP_000783734.1 phage holin, lambda family -
  HZT25_RS06720 (HZT25_06695) - 1372787..1373263 (+) 477 WP_000229392.1 glycoside hydrolase family protein -
  HZT25_RS06725 (HZT25_06700) - 1373260..1373697 (+) 438 WP_240763789.1 lysis protein -
  HZT25_RS06730 (HZT25_06705) - 1373847..1374452 (+) 606 WP_021528610.1 Rha family transcriptional regulator -
  HZT25_RS06735 (HZT25_06710) - 1374680..1374922 (+) 243 WP_000807789.1 DUF2560 family protein -
  HZT25_RS06740 (HZT25_06715) - 1374926..1375213 (+) 288 WP_137546504.1 hypothetical protein -
  HZT25_RS06745 (HZT25_06720) - 1375223..1375402 (+) 180 WP_240763791.1 hypothetical protein -
  HZT25_RS06750 (HZT25_06725) - 1375426..1375914 (+) 489 WP_000729920.1 DNA-packaging protein -
  HZT25_RS06755 (HZT25_06730) - 1375892..1377391 (+) 1500 WP_000417850.1 terminase family protein -
  HZT25_RS06760 (HZT25_06735) - 1377392..1379557 (+) 2166 WP_062810285.1 portal protein -
  HZT25_RS06765 (HZT25_06740) - 1379571..1380482 (+) 912 WP_000373006.1 scaffold protein -
  HZT25_RS06770 (HZT25_06745) - 1380482..1381777 (+) 1296 WP_233331110.1 P22 phage major capsid protein family protein -
  HZT25_RS06775 (HZT25_06750) - 1381822..1382082 (+) 261 WP_023277605.1 hypothetical protein -
  HZT25_RS06780 (HZT25_06755) - 1382060..1382560 (+) 501 WP_219388981.1 packaged DNA stabilization gp4 family protein -
  HZT25_RS06785 (HZT25_06760) - 1382561..1383979 (+) 1419 WP_233331111.1 packaged DNA stabilization protein gp10 -
  HZT25_RS06790 (HZT25_06765) - 1383979..1384932 (+) 954 WP_086623956.1 tail needle knob protein -
  HZT25_RS06795 (HZT25_06770) - 1384932..1385387 (+) 456 WP_086623954.1 DUF2824 family protein -
  HZT25_RS06800 (HZT25_06775) - 1385390..1386082 (+) 693 WP_045133253.1 DNA transfer protein -
  HZT25_RS06805 (HZT25_06780) - 1386093..1387472 (+) 1380 WP_233331112.1 DNA transfer protein -
  HZT25_RS06810 (HZT25_06785) - 1387472..1389301 (+) 1830 WP_233331114.1 DNA transfer protein -
  HZT25_RS06815 (HZT25_06795) - 1389664..1390632 (+) 969 WP_000136767.1 P63C domain-containing protein -
  HZT25_RS06820 (HZT25_06800) - 1390648..1390899 (-) 252 WP_103216231.1 Arc family DNA-binding protein -
  HZT25_RS06825 (HZT25_06805) - 1391046..1392953 (+) 1908 WP_233331113.1 phage tailspike protein -
  HZT25_RS06830 (HZT25_06810) - 1393126..1394346 (-) 1221 WP_000343760.1 ISL3-like element ISKox3 family transposase -
  HZT25_RS06835 - 1394441..1394680 (+) 240 WP_103216233.1 hypothetical protein -
  HZT25_RS06840 (HZT25_06815) - 1394680..1394997 (+) 318 WP_105075735.1 hypothetical protein -
  HZT25_RS06845 (HZT25_06820) intS 1395030..1396187 (-) 1158 WP_233331122.1 prophage integrase IntS -

Sequence


Protein


Download         Length: 171 a.a.        Molecular weight: 19154.34 Da        Isoelectric Point: 7.4686

>NTDB_id=465835 HZT25_RS06595 WP_000168264.1 1360196..1360711(-) (ssb) [Shigella flexneri strain STLEFF_33]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI

Nucleotide


Download         Length: 516 bp        

>NTDB_id=465835 HZT25_RS06595 WP_000168264.1 1360196..1360711(-) (ssb) [Shigella flexneri strain STLEFF_33]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAGTATCTGCGGAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGTGGACAGGATCGGTTCACTACCGAAGTTATCGTAGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAGGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATACCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7L5X6G7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.712

100

0.649

  ssb Glaesserella parasuis strain SC1401

52.486

100

0.556

  ssb Neisseria gonorrhoeae MS11

42.045

100

0.433

  ssb Neisseria meningitidis MC58

41.477

100

0.427