Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HZT26_RS16530 | Genome accession | NZ_CP058839 |
| Coordinates | 3399903..3400439 (+) | Length | 178 a.a. |
| NCBI ID | WP_000168305.1 | Uniprot ID | A0A9P2PPK2 |
| Organism | Shigella flexneri strain STLEFF_34 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3374673..3420753 | 3399903..3400439 | within | 0 |
Gene organization within MGE regions
Location: 3374673..3420753
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT26_RS16415 (HZT26_16310) | - | 3375830..3377284 (+) | 1455 | Protein_3210 | SopA family protein | - |
| HZT26_RS16420 (HZT26_16315) | ubiC | 3377507..3378004 (+) | 498 | WP_001326644.1 | chorismate lyase | - |
| HZT26_RS16425 (HZT26_16320) | ubiA | 3378017..3378889 (+) | 873 | WP_000455227.1 | 4-hydroxybenzoate octaprenyltransferase | - |
| HZT26_RS16430 (HZT26_16325) | plsB | 3379044..3381467 (-) | 2424 | WP_000017354.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
| HZT26_RS16435 (HZT26_16330) | dgkA | 3381638..3382006 (+) | 369 | WP_000002907.1 | diacylglycerol kinase | - |
| HZT26_RS16440 (HZT26_16335) | lexA | 3382116..3382724 (+) | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
| HZT26_RS16445 (HZT26_16340) | dinF | 3382797..3384122 (+) | 1326 | WP_001326646.1 | MATE family efflux transporter DinF | - |
| HZT26_RS16450 (HZT26_16345) | - | 3384238..3384447 (+) | 210 | WP_001030593.1 | CsbD family protein | - |
| HZT26_RS16455 (HZT26_16350) | zur | 3384489..3385004 (-) | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
| HZT26_RS24735 | yjbL | 3385322..3385576 (+) | 255 | WP_000912571.1 | protein YjbL | - |
| HZT26_RS16460 (HZT26_16355) | - | 3385567..3386307 (+) | 741 | WP_000478761.1 | DUF2713 domain-containing protein | - |
| HZT26_RS16465 (HZT26_16360) | dusA | 3386670..3387707 (+) | 1038 | WP_001298868.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| HZT26_RS16470 (HZT26_16365) | pspG | 3387841..3388083 (+) | 243 | WP_000891404.1 | envelope stress response protein PspG | - |
| HZT26_RS16475 (HZT26_16370) | - | 3388249..3389232 (-) | 984 | WP_000235508.1 | quinone oxidoreductase | - |
| HZT26_RS16480 (HZT26_16375) | dnaB | 3389315..3390730 (+) | 1416 | WP_000918363.1 | replicative DNA helicase | - |
| HZT26_RS16485 (HZT26_16380) | alr | 3390783..3391862 (+) | 1080 | WP_001147328.1 | alanine racemase | - |
| HZT26_RS16490 (HZT26_16385) | tyrB | 3392115..3393308 (+) | 1194 | WP_000486985.1 | aromatic amino acid transaminase | - |
| HZT26_RS16495 (HZT26_16390) | - | 3393530..3393750 (-) | 221 | Protein_3227 | hypothetical protein | - |
| HZT26_RS16500 (HZT26_16395) | - | 3393806..3394503 (+) | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| HZT26_RS16505 (HZT26_16400) | - | 3394587..3394790 (-) | 204 | WP_001321562.1 | protein YjbS | - |
| HZT26_RS16510 (HZT26_16405) | aphA | 3395192..3395905 (+) | 714 | WP_001226928.1 | acid phosphatase AphA | - |
| HZT26_RS16515 (HZT26_16410) | - | 3396016..3396432 (+) | 417 | WP_000270375.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| HZT26_RS16520 (HZT26_16415) | - | 3396436..3396792 (+) | 357 | WP_000155657.1 | MmcQ/YjbR family DNA-binding protein | - |
| HZT26_RS16525 (HZT26_16420) | uvrA | 3396827..3399649 (-) | 2823 | WP_000357740.1 | excinuclease ABC subunit UvrA | - |
| HZT26_RS16530 (HZT26_16425) | ssb | 3399903..3400439 (+) | 537 | WP_000168305.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| HZT26_RS16535 (HZT26_16430) | - | 3400598..3401845 (+) | 1248 | WP_000414651.1 | site-specific integrase | - |
| HZT26_RS16540 (HZT26_16435) | - | 3401832..3403370 (+) | 1539 | WP_001333349.1 | site-specific integrase | - |
| HZT26_RS16545 (HZT26_16440) | - | 3403387..3405420 (+) | 2034 | WP_000807722.1 | hypothetical protein | - |
| HZT26_RS16550 (HZT26_16445) | - | 3405413..3405832 (+) | 420 | WP_001062122.1 | hypothetical protein | - |
| HZT26_RS16555 (HZT26_16450) | avs4 | 3405908..3410671 (+) | 4764 | WP_000240574.1 | AVAST type 4 anti-phage nuclease Avs4 | - |
| HZT26_RS16560 | - | 3411516..3412031 (-) | 516 | WP_240763255.1 | abortive infection system antitoxin AbiGi family protein | - |
| HZT26_RS16565 (HZT26_16460) | - | 3412439..3412720 (-) | 282 | WP_001295689.1 | YjcB family protein | - |
| HZT26_RS16570 (HZT26_16465) | pdeC | 3413150..3414736 (+) | 1587 | WP_000019548.1 | c-di-GMP phosphodiesterase PdeC | - |
| HZT26_RS16575 (HZT26_16470) | soxS | 3414739..3415062 (-) | 324 | WP_000019358.1 | superoxide response transcriptional regulator SoxS | - |
| HZT26_RS16580 (HZT26_16475) | soxR | 3415148..3415612 (+) | 465 | WP_000412428.1 | redox-sensitive transcriptional activator SoxR | - |
| HZT26_RS16585 (HZT26_16480) | ghxP | 3416158..3417507 (+) | 1350 | WP_000106882.1 | guanine/hypoxanthine transporter GhxP | - |
| HZT26_RS16590 (HZT26_16485) | - | 3417658..3419307 (+) | 1650 | WP_000402207.1 | Na+/H+ antiporter | - |
| HZT26_RS16595 (HZT26_16490) | espX5 | 3419461..3420753 (-) | 1293 | WP_001270095.1 | T3SS effector pentapeptide repeat protein EspX5 | - |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 18975.00 Da Isoelectric Point: 5.2358
>NTDB_id=465614 HZT26_RS16530 WP_000168305.1 3399903..3400439(+) (ssb) [Shigella flexneri strain STLEFF_34]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
Nucleotide
Download Length: 537 bp
>NTDB_id=465614 HZT26_RS16530 WP_000168305.1 3399903..3400439(+) (ssb) [Shigella flexneri strain STLEFF_34]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
74.444 |
100 |
0.753 |
| ssb | Glaesserella parasuis strain SC1401 |
57.923 |
100 |
0.596 |
| ssb | Neisseria meningitidis MC58 |
48.066 |
100 |
0.489 |
| ssb | Neisseria gonorrhoeae MS11 |
48.066 |
100 |
0.489 |