Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HZT22_RS16515 | Genome accession | NZ_CP058833 |
| Coordinates | 3401103..3401639 (+) | Length | 178 a.a. |
| NCBI ID | WP_000168305.1 | Uniprot ID | A0A9P2PPK2 |
| Organism | Shigella flexneri strain STLEFF_27 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 3375873..3421953 | 3401103..3401639 | within | 0 |
Gene organization within MGE regions
Location: 3375873..3421953
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HZT22_RS16400 (HZT22_16320) | - | 3377030..3378484 (+) | 1455 | Protein_3210 | SopA family protein | - |
| HZT22_RS16405 (HZT22_16325) | ubiC | 3378707..3379204 (+) | 498 | WP_001326644.1 | chorismate lyase | - |
| HZT22_RS16410 (HZT22_16330) | ubiA | 3379217..3380089 (+) | 873 | WP_000455227.1 | 4-hydroxybenzoate octaprenyltransferase | - |
| HZT22_RS16415 (HZT22_16335) | plsB | 3380244..3382667 (-) | 2424 | WP_000017354.1 | glycerol-3-phosphate 1-O-acyltransferase PlsB | - |
| HZT22_RS16420 (HZT22_16340) | dgkA | 3382838..3383206 (+) | 369 | WP_000002907.1 | diacylglycerol kinase | - |
| HZT22_RS16425 (HZT22_16345) | lexA | 3383316..3383924 (+) | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
| HZT22_RS16430 (HZT22_16350) | dinF | 3383997..3385322 (+) | 1326 | WP_001326646.1 | MATE family efflux transporter DinF | - |
| HZT22_RS16435 (HZT22_16355) | - | 3385438..3385647 (+) | 210 | WP_001030593.1 | CsbD family protein | - |
| HZT22_RS16440 (HZT22_16360) | zur | 3385689..3386204 (-) | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
| HZT22_RS24505 | yjbL | 3386522..3386776 (+) | 255 | WP_000912571.1 | protein YjbL | - |
| HZT22_RS16445 (HZT22_16365) | - | 3386800..3387507 (+) | 708 | WP_001311303.1 | DUF2713 domain-containing protein | - |
| HZT22_RS16450 (HZT22_16370) | dusA | 3387870..3388907 (+) | 1038 | WP_001298868.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| HZT22_RS16455 (HZT22_16375) | pspG | 3389041..3389283 (+) | 243 | WP_000891404.1 | envelope stress response protein PspG | - |
| HZT22_RS16460 (HZT22_16380) | - | 3389449..3390432 (-) | 984 | WP_000235508.1 | quinone oxidoreductase | - |
| HZT22_RS16465 (HZT22_16385) | dnaB | 3390515..3391930 (+) | 1416 | WP_000918363.1 | replicative DNA helicase | - |
| HZT22_RS16470 (HZT22_16390) | alr | 3391983..3393062 (+) | 1080 | WP_001147328.1 | alanine racemase | - |
| HZT22_RS16475 (HZT22_16395) | tyrB | 3393315..3394508 (+) | 1194 | WP_000486985.1 | aromatic amino acid transaminase | - |
| HZT22_RS16480 (HZT22_16400) | - | 3394730..3394950 (-) | 221 | Protein_3227 | hypothetical protein | - |
| HZT22_RS16485 (HZT22_16405) | - | 3395006..3395703 (+) | 698 | WP_103215986.1 | IS1-like element IS1A family transposase | - |
| HZT22_RS16490 (HZT22_16410) | - | 3395787..3395990 (-) | 204 | WP_001321562.1 | protein YjbS | - |
| HZT22_RS16495 (HZT22_16415) | aphA | 3396392..3397105 (+) | 714 | WP_001226928.1 | acid phosphatase AphA | - |
| HZT22_RS16500 (HZT22_16420) | - | 3397216..3397632 (+) | 417 | WP_000270375.1 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| HZT22_RS16505 (HZT22_16425) | - | 3397636..3397992 (+) | 357 | WP_000155657.1 | MmcQ/YjbR family DNA-binding protein | - |
| HZT22_RS16510 (HZT22_16430) | uvrA | 3398027..3400849 (-) | 2823 | WP_000357740.1 | excinuclease ABC subunit UvrA | - |
| HZT22_RS16515 (HZT22_16435) | ssb | 3401103..3401639 (+) | 537 | WP_000168305.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| HZT22_RS16520 (HZT22_16440) | - | 3401798..3403045 (+) | 1248 | WP_000414651.1 | site-specific integrase | - |
| HZT22_RS16525 (HZT22_16445) | - | 3403038..3404570 (+) | 1533 | WP_001061276.1 | site-specific integrase | - |
| HZT22_RS16530 (HZT22_16450) | - | 3404587..3406620 (+) | 2034 | WP_000807722.1 | hypothetical protein | - |
| HZT22_RS16535 (HZT22_16455) | - | 3406613..3407032 (+) | 420 | WP_001062122.1 | hypothetical protein | - |
| HZT22_RS16540 (HZT22_16460) | avs4 | 3407108..3411871 (+) | 4764 | WP_000240574.1 | AVAST type 4 anti-phage nuclease Avs4 | - |
| HZT22_RS16545 | - | 3412716..3413231 (-) | 516 | WP_240763255.1 | abortive infection system antitoxin AbiGi family protein | - |
| HZT22_RS16550 (HZT22_16470) | - | 3413639..3413920 (-) | 282 | WP_001295689.1 | YjcB family protein | - |
| HZT22_RS16555 (HZT22_16475) | pdeC | 3414350..3415936 (+) | 1587 | WP_000019548.1 | c-di-GMP phosphodiesterase PdeC | - |
| HZT22_RS16560 (HZT22_16480) | soxS | 3415939..3416262 (-) | 324 | WP_000019358.1 | superoxide response transcriptional regulator SoxS | - |
| HZT22_RS16565 (HZT22_16485) | soxR | 3416348..3416812 (+) | 465 | WP_000412428.1 | redox-sensitive transcriptional activator SoxR | - |
| HZT22_RS16570 (HZT22_16490) | ghxP | 3417358..3418707 (+) | 1350 | WP_000106882.1 | guanine/hypoxanthine transporter GhxP | - |
| HZT22_RS16575 (HZT22_16495) | - | 3418858..3420507 (+) | 1650 | WP_000402207.1 | Na+/H+ antiporter | - |
| HZT22_RS16580 (HZT22_16500) | espX5 | 3420661..3421953 (-) | 1293 | WP_001270095.1 | T3SS effector pentapeptide repeat protein EspX5 | - |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 18975.00 Da Isoelectric Point: 5.2358
>NTDB_id=465592 HZT22_RS16515 WP_000168305.1 3401103..3401639(+) (ssb) [Shigella flexneri strain STLEFF_27]
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
MASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYI
EGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGGRQGGGAPAGGNIGGGQPQGGWGQPQQPQGGNQFSGGAQSRPQQSA
PAAPSNEPPMDFDDDIPF
Nucleotide
Download Length: 537 bp
>NTDB_id=465592 HZT22_RS16515 WP_000168305.1 3401103..3401639(+) (ssb) [Shigella flexneri strain STLEFF_27]
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
ATGGCCAGCAGAGGCGTAAACAAGGTTATTCTCGTTGGTAATCTGGGTCAGGACCCGGAAGTACGCTACATGCCAAATGG
TGGCGCAGTTGCCAACATTACGCTGGCTACTTCCGAATCCTGGCGTGATAAAGCGACCGGCGAGATGAAAGAACAGACTG
AATGGCACCGCGTTGTGCTGTTCGGCAAACTGGCAGAAGTGGCGAGCGAATATCTGCGTAAAGGTTCTCAGGTTTATATC
GAAGGTCAGCTGCGTACCCGTAAATGGACCGATCAATCCGGTCAGGATCGCTACACCACAGAAGTCGTGGTGAACGTTGG
CGGCACCATGCAGATGCTGGGTGGTCGTCAGGGTGGTGGCGCTCCGGCAGGTGGCAATATCGGTGGTGGTCAGCCGCAGG
GCGGTTGGGGTCAGCCTCAGCAGCCGCAGGGTGGCAATCAGTTCAGCGGCGGCGCGCAGTCTCGCCCGCAGCAGTCCGCT
CCGGCAGCGCCGTCTAACGAGCCGCCGATGGACTTTGATGATGACATTCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
74.444 |
100 |
0.753 |
| ssb | Glaesserella parasuis strain SC1401 |
57.923 |
100 |
0.596 |
| ssb | Neisseria meningitidis MC58 |
48.066 |
100 |
0.489 |
| ssb | Neisseria gonorrhoeae MS11 |
48.066 |
100 |
0.489 |