Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HZS99_RS07130 Genome accession   NZ_CP058748
Coordinates   1489292..1489798 (-) Length   168 a.a.
NCBI ID   WP_071447819.1    Uniprot ID   -
Organism   Escherichia coli strain STLIN_13     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1471067..1523261 1489292..1489798 within 0


Gene organization within MGE regions


Location: 1471067..1523261
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HZS99_RS07040 (HZS99_06975) dsdC 1471067..1472014 (+) 948 WP_001361861.1 DNA-binding transcriptional regulator DsdC -
  HZS99_RS07045 (HZS99_06980) ipuB 1472409..1472978 (-) 570 WP_001224627.1 tyrosine-type DNA invertase IpuB -
  HZS99_RS07050 (HZS99_06985) ipuA 1473727..1474356 (+) 630 WP_001181154.1 tyrosine-type DNA invertase IpuA -
  HZS99_RS07055 (HZS99_06990) - 1474674..1475294 (+) 621 WP_000243052.1 LuxR C-terminal-related transcriptional regulator -
  HZS99_RS07060 (HZS99_06995) - 1475319..1483238 (+) 7920 WP_001361862.1 phase-variable autotransporter adhesin UpaE -
  HZS99_RS07065 (HZS99_07000) - 1483286..1483816 (+) 531 WP_000100042.1 hypothetical protein -
  HZS99_RS07070 (HZS99_07005) torI 1484342..1484542 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  HZS99_RS07075 (HZS99_07010) - 1484600..1484767 (-) 168 WP_108997186.1 hypothetical protein -
  HZS99_RS07080 (HZS99_07015) - 1484825..1485625 (-) 801 WP_108997184.1 hypothetical protein -
  HZS99_RS07085 (HZS99_07020) - 1485668..1485952 (-) 285 WP_124053540.1 ASCH domain-containing protein -
  HZS99_RS07090 (HZS99_07025) - 1485945..1486715 (-) 771 WP_233324800.1 hypothetical protein -
  HZS99_RS07095 - 1486716..1486841 (-) 126 Protein_1389 hypothetical protein -
  HZS99_RS07100 (HZS99_07030) - 1486844..1487035 (-) 192 WP_108997177.1 hypothetical protein -
  HZS99_RS07105 (HZS99_07035) - 1487037..1487528 (-) 492 WP_108997175.1 XF1762 family protein -
  HZS99_RS07110 - 1487774..1488226 (-) 453 Protein_1392 ead/Ea22-like family protein -
  HZS99_RS07115 (HZS99_07045) - 1488223..1488810 (-) 588 WP_222563252.1 hypothetical protein -
  HZS99_RS07120 (HZS99_07050) - 1488807..1488971 (-) 165 WP_001214456.1 DUF2737 family protein -
  HZS99_RS07125 (HZS99_07055) - 1488982..1489278 (-) 297 WP_078207967.1 phage anti-RecBCD protein -
  HZS99_RS07130 (HZS99_07060) ssb 1489292..1489798 (-) 507 WP_071447819.1 single-stranded DNA-binding protein Machinery gene
  HZS99_RS07135 (HZS99_07065) - 1489799..1490506 (-) 708 WP_058115767.1 Rad52/Rad22 family DNA repair protein -
  HZS99_RS07140 (HZS99_07070) kil 1490761..1490913 (-) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  HZS99_RS07145 (HZS99_07075) - 1490898..1491029 (-) 132 WP_000638547.1 protease FtsH-inhibitory lysogeny factor CIII -
  HZS99_RS07150 (HZS99_07080) - 1491054..1492022 (-) 969 WP_138217215.1 cell envelope biogenesis protein TolA -
  HZS99_RS07155 (HZS99_07085) - 1492204..1492425 (-) 222 WP_233324796.1 hypothetical protein -
  HZS99_RS07160 (HZS99_07090) - 1492545..1492850 (-) 306 WP_113403480.1 regulator -
  HZS99_RS07165 (HZS99_07095) - 1493165..1493815 (-) 651 WP_001095982.1 LexA family transcriptional regulator -
  HZS99_RS07170 (HZS99_07100) - 1493896..1494081 (+) 186 WP_000276885.1 Cro/CI family transcriptional regulator -
  HZS99_RS07175 (HZS99_07105) - 1494197..1494493 (+) 297 WP_172479720.1 CII family transcriptional regulator -
  HZS99_RS07180 (HZS99_07110) - 1494526..1494672 (+) 147 WP_016238079.1 DUF2740 family protein -
  HZS99_RS07185 (HZS99_07115) - 1494665..1495564 (+) 900 WP_172479722.1 DNA replication protein -
  HZS99_RS07190 (HZS99_07120) - 1495554..1496990 (+) 1437 WP_172479723.1 DnaB-like helicase C-terminal domain-containing protein -
  HZS99_RS07195 (HZS99_07125) - 1497067..1497507 (+) 441 WP_222563253.1 recombination protein NinB -
  HZS99_RS07200 (HZS99_07130) - 1497504..1498094 (+) 591 WP_021560741.1 MT-A70 family methyltransferase -
  HZS99_RS07205 (HZS99_07135) ninD 1498091..1498264 (+) 174 WP_000679700.1 protein NinD -
  HZS99_RS07210 (HZS99_07140) - 1498231..1498407 (+) 177 WP_000113772.1 NinE family protein -
  HZS99_RS07215 (HZS99_07145) - 1498410..1498769 (+) 360 WP_109555390.1 phage protein NinX family protein -
  HZS99_RS07220 (HZS99_07150) - 1498769..1498945 (+) 177 WP_000950973.1 protein NinF -
  HZS99_RS07225 (HZS99_07155) - 1498938..1499150 (+) 213 WP_001286917.1 hypothetical protein -
  HZS99_RS07230 (HZS99_07160) - 1499143..1499433 (+) 291 WP_222563254.1 DUF1364 domain-containing protein -
  HZS99_RS07235 (HZS99_07165) - 1499430..1499792 (+) 363 WP_001008180.1 RusA family crossover junction endodeoxyribonuclease -
  HZS99_RS07240 (HZS99_07170) - 1499789..1499977 (+) 189 WP_000994515.1 protein ninH -
  HZS99_RS07245 (HZS99_07175) - 1499974..1500597 (+) 624 WP_001235461.1 antitermination protein -
  HZS99_RS07250 (HZS99_07180) - 1501701..1502024 (+) 324 WP_000783734.1 phage holin, lambda family -
  HZS99_RS07255 (HZS99_07185) - 1502008..1502484 (+) 477 WP_089564108.1 glycoside hydrolase family protein -
  HZS99_RS07260 (HZS99_07190) - 1502481..1502948 (+) 468 WP_138217227.1 lysis protein -
  HZS99_RS07265 (HZS99_07195) - 1502936..1503088 (+) 153 WP_001139681.1 hypothetical protein -
  HZS99_RS07270 (HZS99_07200) - 1503253..1503495 (+) 243 WP_000807788.1 DUF2560 family protein -
  HZS99_RS07275 (HZS99_07205) - 1503531..1504019 (+) 489 WP_000729920.1 DNA-packaging protein -
  HZS99_RS07280 (HZS99_07210) - 1503997..1505496 (+) 1500 WP_000417851.1 terminase family protein -
  HZS99_RS07285 (HZS99_07215) - 1505497..1507662 (+) 2166 WP_023486193.1 portal protein -
  HZS99_RS07290 (HZS99_07220) - 1507676..1508587 (+) 912 WP_000373010.1 scaffold protein -
  HZS99_RS07295 (HZS99_07225) - 1508587..1509882 (+) 1296 WP_222563255.1 P22 phage major capsid protein family protein -
  HZS99_RS07300 (HZS99_07230) - 1509927..1510181 (+) 255 WP_106382293.1 hypothetical protein -
  HZS99_RS07305 (HZS99_07235) - 1510159..1510659 (+) 501 WP_032153671.1 packaged DNA stabilization gp4 family protein -
  HZS99_RS07310 (HZS99_07240) - 1510659..1512077 (+) 1419 WP_222563256.1 packaged DNA stabilization protein gp10 -
  HZS99_RS07315 (HZS99_07245) - 1512077..1513030 (+) 954 WP_087503464.1 tail needle knob protein -
  HZS99_RS07320 (HZS99_07250) - 1513030..1513485 (+) 456 WP_087503465.1 DUF2824 family protein -
  HZS99_RS07325 (HZS99_07255) - 1513488..1514180 (+) 693 WP_087503466.1 DNA transfer protein -
  HZS99_RS07330 (HZS99_07260) - 1514190..1515521 (+) 1332 WP_087503467.1 phage DNA ejection protein -
  HZS99_RS07335 (HZS99_07265) - 1515522..1517915 (+) 2394 WP_087503468.1 lytic transglycosylase domain-containing protein -
  HZS99_RS07340 (HZS99_07270) - 1518080..1520479 (+) 2400 WP_029701265.1 phage head-binding domain-containing protein -
  HZS99_RS07345 (HZS99_07275) - 1520599..1521135 (-) 537 WP_060579112.1 GDSL-type esterase/lipase family protein -
  HZS99_RS07350 (HZS99_07280) - 1521331..1521987 (+) 657 WP_016242483.1 DUF1796 family putative cysteine peptidase -
  HZS99_RS07355 (HZS99_07285) intS 1522104..1523261 (-) 1158 WP_222563258.1 prophage integrase IntS -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18761.06 Da        Isoelectric Point: 8.4877

>NTDB_id=465310 HZS99_RS07130 WP_071447819.1 1489292..1489798(-) (ssb) [Escherichia coli strain STLIN_13]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGSIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=465310 HZS99_RS07130 WP_071447819.1 1489292..1489798(-) (ssb) [Escherichia coli strain STLIN_13]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAAATGCTTGGCAGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

61.798

100

0.655

  ssb Glaesserella parasuis strain SC1401

45.856

100

0.494

  ssb Neisseria meningitidis MC58

38.068

100

0.399

  ssb Neisseria gonorrhoeae MS11

38.068

100

0.399