Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HYQ43_RS04525 Genome accession   NZ_CP058689
Coordinates   921234..921674 (-) Length   146 a.a.
NCBI ID   WP_179921091.1    Uniprot ID   A0A7H9BQD3
Organism   Paracoccus pantotrophus strain ACCC10489     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 916030..948565 921234..921674 within 0


Gene organization within MGE regions


Location: 916030..948565
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HYQ43_RS04465 (HYQ43_04465) - 916030..917025 (-) 996 WP_257154196.1 tyrosine-type recombinase/integrase -
  HYQ43_RS04470 (HYQ43_04470) - 917034..917198 (-) 165 WP_155987319.1 hypothetical protein -
  HYQ43_RS04475 (HYQ43_04475) - 917199..917843 (-) 645 WP_179921075.1 hypothetical protein -
  HYQ43_RS04480 (HYQ43_04480) - 917836..917994 (-) 159 WP_179921077.1 hypothetical protein -
  HYQ43_RS04485 (HYQ43_04485) - 917994..918458 (-) 465 WP_179921079.1 hypothetical protein -
  HYQ43_RS04490 (HYQ43_04490) - 918458..919105 (-) 648 WP_179921081.1 hypothetical protein -
  HYQ43_RS04495 (HYQ43_04495) - 919095..919634 (-) 540 WP_179921083.1 hypothetical protein -
  HYQ43_RS04500 (HYQ43_04500) - 919631..920068 (-) 438 WP_257154197.1 hypothetical protein -
  HYQ43_RS04505 (HYQ43_04505) - 920095..920448 (-) 354 WP_179921085.1 HNH endonuclease -
  HYQ43_RS04510 (HYQ43_04510) - 920445..920630 (-) 186 WP_072461522.1 hypothetical protein -
  HYQ43_RS04515 (HYQ43_04515) - 920627..921019 (-) 393 WP_179921087.1 recombination protein NinB -
  HYQ43_RS04520 (HYQ43_04520) - 921019..921225 (-) 207 WP_179921089.1 hypothetical protein -
  HYQ43_RS04525 (HYQ43_04525) ssb 921234..921674 (-) 441 WP_179921091.1 single-stranded DNA-binding protein Machinery gene
  HYQ43_RS04530 (HYQ43_04530) - 921674..922282 (-) 609 WP_257154198.1 hypothetical protein -
  HYQ43_RS04535 (HYQ43_04535) - 922381..923181 (-) 801 WP_179921095.1 ERF family protein -
  HYQ43_RS04540 (HYQ43_04540) - 923191..923532 (-) 342 WP_179921097.1 hypothetical protein -
  HYQ43_RS04545 (HYQ43_04545) - 923529..924068 (-) 540 WP_179921099.1 hypothetical protein -
  HYQ43_RS04550 (HYQ43_04550) - 924193..924573 (-) 381 WP_179921101.1 hypothetical protein -
  HYQ43_RS04555 (HYQ43_04555) - 924573..924767 (-) 195 WP_179921103.1 hypothetical protein -
  HYQ43_RS04560 (HYQ43_04560) - 924767..925072 (-) 306 WP_179921105.1 hypothetical protein -
  HYQ43_RS04565 (HYQ43_04565) - 925069..925251 (-) 183 WP_179921107.1 hypothetical protein -
  HYQ43_RS04570 (HYQ43_04570) - 926020..926208 (+) 189 WP_179921110.1 hypothetical protein -
  HYQ43_RS04575 (HYQ43_04575) - 926297..926782 (-) 486 WP_179921113.1 DUF2335 domain-containing protein -
  HYQ43_RS04580 (HYQ43_04580) - 926730..926969 (-) 240 WP_179921115.1 hypothetical protein -
  HYQ43_RS04585 (HYQ43_04585) - 927107..927331 (-) 225 WP_179921117.1 hypothetical protein -
  HYQ43_RS23655 (HYQ43_04590) - 927491..927910 (-) 420 WP_420892177.1 helix-turn-helix domain-containing protein -
  HYQ43_RS23660 (HYQ43_04595) - 927920..928141 (+) 222 WP_420892181.1 helix-turn-helix transcriptional regulator -
  HYQ43_RS04600 (HYQ43_04600) - 928507..928701 (+) 195 WP_179921123.1 hypothetical protein -
  HYQ43_RS04605 (HYQ43_04605) - 928698..928910 (+) 213 WP_257154200.1 hypothetical protein -
  HYQ43_RS04610 (HYQ43_04610) - 928910..929440 (+) 531 WP_179921125.1 class I SAM-dependent methyltransferase -
  HYQ43_RS04615 (HYQ43_04615) - 929505..929702 (+) 198 WP_179921127.1 hypothetical protein -
  HYQ43_RS04620 (HYQ43_04620) - 929702..930067 (+) 366 WP_179921129.1 endodeoxyribonuclease RusA -
  HYQ43_RS04625 (HYQ43_04625) - 930064..930822 (+) 759 WP_179921131.1 helix-turn-helix domain-containing protein -
  HYQ43_RS04630 (HYQ43_04630) - 930800..931444 (+) 645 WP_155987338.1 hypothetical protein -
  HYQ43_RS04635 (HYQ43_04635) - 931441..931728 (+) 288 WP_179921133.1 helix-turn-helix domain-containing protein -
  HYQ43_RS04640 (HYQ43_04640) - 931725..932255 (+) 531 Protein_928 hypothetical protein -
  HYQ43_RS04645 (HYQ43_04645) - 932433..933077 (+) 645 WP_179921135.1 hypothetical protein -
  HYQ43_RS04650 (HYQ43_04650) - 933080..933766 (+) 687 WP_179921137.1 hypothetical protein -
  HYQ43_RS04655 (HYQ43_04655) - 933763..935358 (+) 1596 WP_218927414.1 hypothetical protein -
  HYQ43_RS04660 (HYQ43_04660) - 935355..935738 (+) 384 WP_028711067.1 GNAT family N-acetyltransferase -
  HYQ43_RS04665 (HYQ43_04665) - 935927..937327 (+) 1401 WP_179921141.1 hypothetical protein -
  HYQ43_RS04670 (HYQ43_04670) - 937324..938853 (+) 1530 WP_179921143.1 hypothetical protein -
  HYQ43_RS04675 (HYQ43_04675) - 939010..939366 (-) 357 WP_036765984.1 hypothetical protein -
  HYQ43_RS04680 (HYQ43_04680) - 939446..940480 (+) 1035 WP_179921145.1 hypothetical protein -
  HYQ43_RS04685 (HYQ43_04685) - 940480..940671 (+) 192 WP_179921147.1 hypothetical protein -
  HYQ43_RS04690 (HYQ43_04690) - 940668..940841 (+) 174 WP_179921149.1 hypothetical protein -
  HYQ43_RS04695 (HYQ43_04695) - 940906..943107 (+) 2202 WP_179921151.1 hypothetical protein -
  HYQ43_RS04700 (HYQ43_04700) - 943119..943388 (+) 270 WP_179921153.1 hypothetical protein -
  HYQ43_RS04705 (HYQ43_04705) - 943391..943600 (+) 210 WP_179921155.1 hypothetical protein -
  HYQ43_RS04710 (HYQ43_04710) - 943597..944250 (+) 654 WP_179921157.1 hypothetical protein -
  HYQ43_RS04715 (HYQ43_04715) - 944247..944429 (+) 183 WP_179921159.1 hypothetical protein -
  HYQ43_RS04720 (HYQ43_04720) - 944565..944768 (+) 204 WP_179921161.1 hypothetical protein -
  HYQ43_RS04725 (HYQ43_04725) - 944759..945112 (-) 354 WP_179921163.1 hypothetical protein -
  HYQ43_RS04730 (HYQ43_04730) - 945311..945499 (-) 189 WP_028711080.1 hypothetical protein -
  HYQ43_RS04735 (HYQ43_04735) - 945527..945841 (-) 315 WP_179921165.1 hypothetical protein -
  HYQ43_RS04740 (HYQ43_04740) - 945949..946146 (+) 198 Protein_948 winged helix-turn-helix domain-containing protein -
  HYQ43_RS04745 (HYQ43_04745) ligA 946268..948565 (+) 2298 WP_024844473.1 NAD-dependent DNA ligase LigA -

Sequence


Protein


Download         Length: 146 a.a.        Molecular weight: 16266.97 Da        Isoelectric Point: 5.0500

>NTDB_id=464947 HYQ43_RS04525 WP_179921091.1 921234..921674(-) (ssb) [Paracoccus pantotrophus strain ACCC10489]
MADLNRVSLLGRLGADPEIRQTQSGEKVATFRIATGEQWKDKSTGEKKERTEWHTVVAWGPLAQIAEKYLAKGKRVYAEG
PQRTRKWQDQSGNDRYSTEVVLSGFGARLDVIDWPEGGGAARGQEESYGGDNLPPSRPDFDDDIPF

Nucleotide


Download         Length: 441 bp        

>NTDB_id=464947 HYQ43_RS04525 WP_179921091.1 921234..921674(-) (ssb) [Paracoccus pantotrophus strain ACCC10489]
ATGGCTGACCTGAACCGCGTTTCCCTTCTCGGCCGACTCGGCGCCGATCCTGAAATCCGACAGACCCAGAGCGGGGAAAA
GGTCGCAACCTTCCGCATCGCCACGGGCGAACAGTGGAAGGACAAGAGCACTGGCGAGAAGAAAGAGCGCACAGAATGGC
ATACGGTAGTCGCTTGGGGACCGCTCGCCCAGATCGCAGAGAAGTATCTGGCGAAAGGCAAGCGCGTCTATGCGGAAGGT
CCGCAGCGCACCCGCAAATGGCAGGACCAGAGCGGCAACGACAGATATTCGACCGAGGTCGTTCTGTCAGGCTTTGGCGC
GCGCCTTGACGTGATCGACTGGCCGGAAGGCGGCGGTGCGGCTCGCGGTCAGGAGGAAAGCTACGGCGGCGACAACCTGC
CCCCGAGCCGTCCTGATTTCGATGACGATATTCCGTTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7H9BQD3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

44.886

100

0.541

  ssb Glaesserella parasuis strain SC1401

39.011

100

0.486

  ssb Neisseria meningitidis MC58

36.416

100

0.432

  ssb Neisseria gonorrhoeae MS11

36.416

100

0.432