Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SA2981_RS10465 | Genome accession | NC_017340 |
| Coordinates | 2069878..2070348 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934759.1 | Uniprot ID | A0A2I7Y8V1 |
| Organism | Staphylococcus aureus 04-02981 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2039558..2094713 | 2069878..2070348 | within | 0 |
Gene organization within MGE regions
Location: 2039558..2094713
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA2981_RS10255 (SA2981_1901) | scn | 2039558..2039908 (-) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SA2981_RS10260 (SA2981_1902) | - | 2040591..2041040 (+) | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| SA2981_RS10265 | - | 2041135..2041469 (-) | 335 | Protein_1950 | SH3 domain-containing protein | - |
| SA2981_RS10270 (SA2981_1905) | sak | 2042116..2042607 (-) | 492 | WP_000920042.1 | staphylokinase | - |
| SA2981_RS10275 (SA2981_1906) | - | 2042798..2043553 (-) | 756 | WP_000861026.1 | CHAP domain-containing protein | - |
| SA2981_RS10280 (SA2981_1907) | - | 2043565..2043819 (-) | 255 | WP_000611512.1 | phage holin | - |
| SA2981_RS10285 | - | 2043871..2043978 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SA2981_RS14780 (SA2981_1908) | pepG1 | 2044031..2044165 (-) | 135 | WP_000226108.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SA2981_RS10295 (SA2981_1909) | sep | 2044410..2045192 (-) | 783 | WP_000034846.1 | staphylococcal enterotoxin type P | - |
| SA2981_RS10300 (SA2981_1911) | - | 2045604..2045978 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| SA2981_RS10305 (SA2981_1912) | - | 2046034..2046321 (-) | 288 | WP_001262621.1 | hypothetical protein | - |
| SA2981_RS10310 (SA2981_1913) | - | 2046367..2046519 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| SA2981_RS10315 (SA2981_1914) | - | 2046512..2050294 (-) | 3783 | WP_000582152.1 | phage tail spike protein | - |
| SA2981_RS10320 (SA2981_1915) | - | 2050310..2051794 (-) | 1485 | WP_000567396.1 | phage tail domain-containing protein | - |
| SA2981_RS10325 (SA2981_1916) | - | 2051791..2056320 (-) | 4530 | WP_000504566.1 | phage tail tape measure protein | - |
| SA2981_RS15170 | - | 2056377..2056514 (-) | 138 | WP_001549167.1 | hypothetical protein | - |
| SA2981_RS10335 (SA2981_1917) | - | 2056565..2056915 (-) | 351 | WP_001096355.1 | hypothetical protein | - |
| SA2981_RS14785 | - | 2056965..2057195 (-) | 231 | Protein_1965 | Ig-like domain-containing protein | - |
| SA2981_RS10340 (SA2981_1919) | - | 2057231..2057875 (-) | 645 | WP_000268740.1 | major tail protein | - |
| SA2981_RS10345 (SA2981_1920) | - | 2057876..2058283 (-) | 408 | WP_000565498.1 | hypothetical protein | - |
| SA2981_RS10350 (SA2981_1921) | - | 2058280..2058684 (-) | 405 | WP_000114226.1 | HK97 gp10 family phage protein | - |
| SA2981_RS10355 (SA2981_1922) | - | 2058681..2059043 (-) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| SA2981_RS10360 (SA2981_1923) | - | 2059027..2059311 (-) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| SA2981_RS10365 (SA2981_1924) | - | 2059301..2059585 (-) | 285 | WP_000238236.1 | hypothetical protein | - |
| SA2981_RS10370 (SA2981_1925) | - | 2059605..2060750 (-) | 1146 | WP_000154559.1 | phage major capsid protein | - |
| SA2981_RS10375 (SA2981_1926) | - | 2060774..2061511 (-) | 738 | WP_000642728.1 | head maturation protease, ClpP-related | - |
| SA2981_RS10380 (SA2981_1927) | - | 2061495..2062682 (-) | 1188 | WP_000025274.1 | phage portal protein | - |
| SA2981_RS10385 (SA2981_1928) | - | 2062698..2064359 (-) | 1662 | WP_000625088.1 | terminase large subunit | - |
| SA2981_RS10390 (SA2981_1929) | - | 2064356..2064700 (-) | 345 | WP_000402904.1 | hypothetical protein | - |
| SA2981_RS10395 (SA2981_1930) | - | 2064832..2065131 (-) | 300 | WP_000988332.1 | HNH endonuclease | - |
| SA2981_RS10400 (SA2981_1931) | - | 2065363..2065779 (-) | 417 | WP_000590122.1 | hypothetical protein | - |
| SA2981_RS10405 (SA2981_1932) | - | 2065807..2066007 (-) | 201 | WP_001557462.1 | DUF1514 family protein | - |
| SA2981_RS10410 (SA2981_1933) | - | 2066007..2066156 (-) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| SA2981_RS10415 (SA2981_1934) | - | 2066153..2066359 (-) | 207 | WP_000195784.1 | DUF1381 domain-containing protein | - |
| SA2981_RS10420 (SA2981_1935) | - | 2066356..2066601 (-) | 246 | WP_001282077.1 | hypothetical protein | - |
| SA2981_RS10425 (SA2981_1936) | - | 2066638..2067174 (-) | 537 | WP_000185693.1 | dUTPase | - |
| SA2981_RS10430 (SA2981_1937) | - | 2067171..2067416 (-) | 246 | WP_001065108.1 | DUF1024 family protein | - |
| SA2981_RS10435 (SA2981_1938) | - | 2067431..2067679 (-) | 249 | WP_000178987.1 | SAV1978 family virulence-associated passenger protein | - |
| SA2981_RS10440 (SA2981_1939) | - | 2067676..2067933 (-) | 258 | WP_000111491.1 | DUF3310 domain-containing protein | - |
| SA2981_RS10445 (SA2981_1940) | - | 2067933..2068304 (-) | 372 | WP_000101279.1 | SA1788 family PVL leukocidin-associated protein | - |
| SA2981_RS10450 (SA2981_1941) | - | 2068317..2068721 (-) | 405 | WP_000401969.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SA2981_RS10455 (SA2981_1942) | - | 2068730..2068948 (-) | 219 | WP_000338528.1 | hypothetical protein | - |
| SA2981_RS10460 (SA2981_1943) | - | 2068955..2069848 (-) | 894 | WP_000148333.1 | DnaD domain-containing protein | - |
| SA2981_RS10465 (SA2981_1944) | ssbA | 2069878..2070348 (-) | 471 | WP_000934759.1 | single-stranded DNA-binding protein | Machinery gene |
| SA2981_RS10470 (SA2981_1945) | - | 2070349..2070966 (-) | 618 | WP_064135358.1 | MBL fold metallo-hydrolase | - |
| SA2981_RS10475 (SA2981_1946) | - | 2071047..2071967 (-) | 921 | WP_000180600.1 | recombinase RecT | - |
| SA2981_RS10480 (SA2981_1947) | - | 2071969..2073912 (-) | 1944 | WP_000700554.1 | AAA family ATPase | - |
| SA2981_RS14790 (SA2981_1948) | - | 2073921..2074184 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SA2981_RS10485 (SA2981_1949) | - | 2074193..2074453 (-) | 261 | WP_000291510.1 | DUF1108 family protein | - |
| SA2981_RS10490 (SA2981_1950) | - | 2074458..2074760 (-) | 303 | WP_000165371.1 | DUF2482 family protein | - |
| SA2981_RS10495 (SA2981_1951) | - | 2074855..2075016 (-) | 162 | WP_000048129.1 | DUF1270 family protein | - |
| SA2981_RS10500 (SA2981_1952) | - | 2075013..2075336 (-) | 324 | WP_001120201.1 | DUF771 domain-containing protein | - |
| SA2981_RS10505 (SA2981_1953) | - | 2075391..2075771 (+) | 381 | WP_000762521.1 | DUF2513 domain-containing protein | - |
| SA2981_RS10510 (SA2981_1954) | - | 2075758..2075955 (-) | 198 | WP_001148856.1 | hypothetical protein | - |
| SA2981_RS10515 (SA2981_1955) | - | 2075971..2076723 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| SA2981_RS10520 (SA2981_1956) | - | 2076774..2077103 (+) | 330 | WP_000128909.1 | hypothetical protein | - |
| SA2981_RS10525 (SA2981_1957) | - | 2077092..2077307 (-) | 216 | WP_001025404.1 | MW1434 family type I TA system toxin | - |
| SA2981_RS10530 (SA2981_1958) | - | 2077323..2077586 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| SA2981_RS10535 | - | 2077583..2077757 (-) | 175 | Protein_2006 | transcriptional regulator | - |
| SA2981_RS10540 (SA2981_1959) | - | 2077720..2078433 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| SA2981_RS10545 (SA2981_1960) | - | 2078449..2079381 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| SA2981_RS10550 | - | 2079387..2079728 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| SA2981_RS10555 (SA2981_1961) | - | 2079932..2080114 (+) | 183 | WP_000694772.1 | hypothetical protein | - |
| SA2981_RS10560 (SA2981_1962) | - | 2080214..2081197 (+) | 984 | WP_001558608.1 | glycosyltransferase family 2 protein | - |
| SA2981_RS10565 (SA2981_1963) | - | 2081208..2081450 (+) | 243 | WP_000427213.1 | hypothetical protein | - |
| SA2981_RS10570 (SA2981_1964) | - | 2081513..2082550 (+) | 1038 | WP_000857180.1 | site-specific integrase | - |
| SA2981_RS10575 (SA2981_1965) | sph | 2082601..2083431 (+) | 831 | Protein_2014 | sphingomyelin phosphodiesterase | - |
| SA2981_RS10580 (SA2981_1966) | lukG | 2083669..2084685 (-) | 1017 | WP_000595392.1 | bi-component leukocidin LukGH subunit G | - |
| SA2981_RS10585 (SA2981_1967) | lukH | 2084707..2085762 (-) | 1056 | WP_000791411.1 | bi-component leukocidin LukGH subunit H | - |
| SA2981_RS10590 (SA2981_1968) | - | 2086198..2087421 (+) | 1224 | WP_000206625.1 | ArgE/DapE family deacylase | - |
| SA2981_RS10595 (SA2981_1969) | - | 2087865..2089172 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| SA2981_RS10600 (SA2981_1970) | groL | 2089712..2091328 (-) | 1617 | WP_000240655.1 | chaperonin GroEL | - |
| SA2981_RS10605 (SA2981_1971) | groES | 2091404..2091688 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
| SA2981_RS10610 (SA2981_1972) | mroQ | 2091863..2092606 (+) | 744 | WP_000197635.1 | CPBP family intramembrane glutamic endopeptidase MroQ | - |
| SA2981_RS10615 (SA2981_1973) | - | 2092631..2093890 (-) | 1260 | WP_000120297.1 | SdrH family protein | - |
| SA2981_RS10620 (SA2981_1974) | - | 2094087..2094713 (+) | 627 | WP_000522381.1 | nitroreductase family protein | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17641.52 Da Isoelectric Point: 5.2672
>NTDB_id=46400 SA2981_RS10465 WP_000934759.1 2069878..2070348(-) (ssbA) [Staphylococcus aureus 04-02981]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=46400 SA2981_RS10465 WP_000934759.1 2069878..2070348(-) (ssbA) [Staphylococcus aureus 04-02981]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |