Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | HW113_RS04140 | Genome accession | NZ_CP058312 |
| Coordinates | 840177..840647 (+) | Length | 156 a.a. |
| NCBI ID | WP_000934770.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain BLR-DV | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 822969..870778 | 840177..840647 | within | 0 |
Gene organization within MGE regions
Location: 822969..870778
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW113_RS04015 (HW113_04015) | - | 822969..823814 (+) | 846 | WP_000812008.1 | class I SAM-dependent methyltransferase | - |
| HW113_RS04020 (HW113_04020) | - | 824186..825409 (-) | 1224 | WP_000206638.1 | ArgE/DapE family deacylase | - |
| HW113_RS04025 (HW113_04025) | lukH | 825844..826899 (+) | 1056 | WP_000791407.1 | bi-component leukocidin LukGH subunit H | - |
| HW113_RS04030 (HW113_04030) | lukG | 826921..827937 (+) | 1017 | WP_000595324.1 | bi-component leukocidin LukGH subunit G | - |
| HW113_RS04035 (HW113_04035) | sph | 828175..828999 (-) | 825 | Protein_790 | sphingomyelin phosphodiesterase | - |
| HW113_RS04040 (HW113_04040) | - | 829056..830093 (-) | 1038 | WP_000857198.1 | site-specific integrase | - |
| HW113_RS04045 (HW113_04045) | - | 830266..830805 (-) | 540 | WP_000391618.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| HW113_RS04050 (HW113_04050) | - | 830945..831112 (-) | 168 | WP_000705238.1 | hypothetical protein | - |
| HW113_RS04055 (HW113_04055) | - | 831312..831497 (-) | 186 | WP_001089804.1 | hypothetical protein | - |
| HW113_RS04060 (HW113_04060) | - | 831484..831639 (-) | 156 | WP_001049399.1 | hypothetical protein | - |
| HW113_RS04065 (HW113_04065) | - | 831651..832358 (-) | 708 | WP_000094093.1 | XRE family transcriptional regulator | - |
| HW113_RS04070 (HW113_04070) | - | 832529..832768 (+) | 240 | WP_112366605.1 | helix-turn-helix transcriptional regulator | - |
| HW113_RS04075 (HW113_04075) | - | 832781..833041 (+) | 261 | WP_000435341.1 | transcriptional regulator | - |
| HW113_RS04080 (HW113_04080) | - | 833065..833604 (-) | 540 | WP_000351243.1 | hypothetical protein | - |
| HW113_RS04085 (HW113_04085) | - | 833661..834413 (+) | 753 | WP_001148618.1 | phage antirepressor KilAC domain-containing protein | - |
| HW113_RS04090 (HW113_04090) | - | 834430..834624 (+) | 195 | WP_000388066.1 | hypothetical protein | - |
| HW113_RS04095 (HW113_04095) | - | 834655..834795 (+) | 141 | WP_000939496.1 | hypothetical protein | - |
| HW113_RS04100 (HW113_04100) | - | 834810..835442 (-) | 633 | WP_000275058.1 | hypothetical protein | - |
| HW113_RS04105 (HW113_04105) | - | 835501..835821 (+) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| HW113_RS04110 (HW113_04110) | - | 835818..835979 (+) | 162 | WP_000066020.1 | DUF1270 domain-containing protein | - |
| HW113_RS04115 (HW113_04115) | - | 836072..836332 (+) | 261 | WP_000291489.1 | DUF1108 family protein | - |
| HW113_RS04120 (HW113_04120) | - | 836341..836604 (+) | 264 | WP_001205732.1 | hypothetical protein | - |
| HW113_RS04125 (HW113_04125) | - | 836613..838556 (+) | 1944 | WP_000700565.1 | AAA family ATPase | - |
| HW113_RS04130 (HW113_04130) | - | 838558..839478 (+) | 921 | WP_000138481.1 | recombinase RecT | - |
| HW113_RS04135 (HW113_04135) | - | 839559..840176 (+) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| HW113_RS04140 (HW113_04140) | ssbA | 840177..840647 (+) | 471 | WP_000934770.1 | single-stranded DNA-binding protein | Machinery gene |
| HW113_RS04145 (HW113_04145) | - | 840677..841561 (+) | 885 | WP_000148298.1 | DnaD domain protein | - |
| HW113_RS04150 (HW113_04150) | - | 841568..841786 (+) | 219 | WP_000338530.1 | hypothetical protein | - |
| HW113_RS04155 (HW113_04155) | - | 841795..842199 (+) | 405 | WP_112366602.1 | RusA family crossover junction endodeoxyribonuclease | - |
| HW113_RS04160 (HW113_04160) | - | 842212..842580 (+) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| HW113_RS04165 (HW113_04165) | - | 842584..842826 (+) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| HW113_RS04170 (HW113_04170) | - | 842891..843340 (+) | 450 | WP_000982711.1 | YopX family protein | - |
| HW113_RS04175 (HW113_04175) | - | 843337..843846 (+) | 510 | WP_001105598.1 | hypothetical protein | - |
| HW113_RS04180 (HW113_04180) | - | 843843..844253 (+) | 411 | WP_000197967.1 | hypothetical protein | - |
| HW113_RS04185 (HW113_04185) | - | 844246..844782 (+) | 537 | WP_112366603.1 | dUTP diphosphatase | - |
| HW113_RS04190 (HW113_04190) | - | 844819..845025 (+) | 207 | WP_000195820.1 | DUF1381 domain-containing protein | - |
| HW113_RS04195 (HW113_04195) | rinB | 845022..845171 (+) | 150 | WP_000595265.1 | transcriptional activator RinB | - |
| HW113_RS04200 (HW113_04200) | - | 845171..845371 (+) | 201 | WP_000265039.1 | DUF1514 family protein | - |
| HW113_RS04205 (HW113_04205) | - | 845399..845815 (+) | 417 | WP_000590126.1 | hypothetical protein | - |
| HW113_RS04210 (HW113_04210) | - | 846047..846346 (+) | 300 | WP_000988336.1 | HNH endonuclease | - |
| HW113_RS04215 (HW113_04215) | - | 846477..846821 (+) | 345 | WP_000402904.1 | hypothetical protein | - |
| HW113_RS04220 (HW113_04220) | - | 846818..848479 (+) | 1662 | WP_000625088.1 | terminase large subunit | - |
| HW113_RS04225 (HW113_04225) | - | 848495..849682 (+) | 1188 | WP_112366570.1 | phage portal protein | - |
| HW113_RS04230 (HW113_04230) | - | 849666..850403 (+) | 738 | WP_000861914.1 | head maturation protease, ClpP-related | - |
| HW113_RS04235 (HW113_04235) | - | 850427..851572 (+) | 1146 | WP_000154555.1 | phage major capsid protein | - |
| HW113_RS04240 (HW113_04240) | - | 851592..851876 (+) | 285 | WP_000238236.1 | hypothetical protein | - |
| HW113_RS04245 (HW113_04245) | - | 851866..852150 (+) | 285 | WP_000150936.1 | phage head-tail adapter protein | - |
| HW113_RS04250 (HW113_04250) | - | 852134..852496 (+) | 363 | WP_000755150.1 | head-tail adaptor protein | - |
| HW113_RS04255 (HW113_04255) | - | 852493..852897 (+) | 405 | WP_000114225.1 | HK97 gp10 family phage protein | - |
| HW113_RS04260 (HW113_04260) | - | 852894..853301 (+) | 408 | WP_000565498.1 | hypothetical protein | - |
| HW113_RS04265 (HW113_04265) | - | 853302..853946 (+) | 645 | WP_000268741.1 | major tail protein | - |
| HW113_RS04270 (HW113_04270) | - | 854000..854212 (+) | 213 | WP_230402383.1 | Ig-like domain-containing protein | - |
| HW113_RS04275 (HW113_04275) | gpG | 854262..854612 (+) | 351 | WP_001096355.1 | phage tail assembly chaperone G | - |
| HW113_RS04280 (HW113_04280) | gpGT | 854663..854800 (+) | 138 | WP_001549167.1 | phage tail assembly chaperone GT | - |
| HW113_RS04285 (HW113_04285) | - | 854857..859386 (+) | 4530 | Protein_840 | phage tail tape measure protein | - |
| HW113_RS04290 (HW113_04290) | - | 859383..860867 (+) | 1485 | WP_000567408.1 | phage tail domain-containing protein | - |
| HW113_RS04295 (HW113_04295) | - | 860883..864676 (+) | 3794 | Protein_842 | phage tail spike protein | - |
| HW113_RS04300 (HW113_04300) | - | 864669..864821 (+) | 153 | WP_001000058.1 | hypothetical protein | - |
| HW113_RS04305 (HW113_04305) | - | 864868..865155 (+) | 288 | WP_001040259.1 | hypothetical protein | - |
| HW113_RS04310 (HW113_04310) | - | 865211..865585 (+) | 375 | WP_000340977.1 | hypothetical protein | - |
| HW113_RS04315 (HW113_04315) | sea | 865958..866731 (+) | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| HW113_RS04320 (HW113_04320) | pepG1 | 866882..867016 (+) | 135 | WP_000226106.1 | type I toxin-antitoxin system toxin PepG1 | - |
| HW113_RS04325 (HW113_04325) | - | 867069..867176 (-) | 108 | Protein_848 | hypothetical protein | - |
| HW113_RS04330 (HW113_04330) | - | 867228..867482 (+) | 255 | WP_000611512.1 | phage holin | - |
| HW113_RS04335 (HW113_04335) | - | 867494..868249 (+) | 756 | Protein_850 | CHAP domain-containing protein | - |
| HW113_RS04340 (HW113_04340) | sak | 868440..868931 (+) | 492 | WP_000920041.1 | staphylokinase | - |
| HW113_RS04345 (HW113_04345) | - | 869580..869918 (+) | 339 | Protein_852 | SH3 domain-containing protein | - |
| HW113_RS04350 (HW113_04350) | scn | 870428..870778 (+) | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17713.63 Da Isoelectric Point: 5.2672
>NTDB_id=463682 HW113_RS04140 WP_000934770.1 840177..840647(+) (ssbA) [Staphylococcus aureus strain BLR-DV]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANVPIEIDDNDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=463682 HW113_RS04140 WP_000934770.1 840177..840647(+) (ssbA) [Staphylococcus aureus strain BLR-DV]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGTTCCGATTGAAATAGATGACAATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.367 |
100 |
0.628 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.551 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
32.203 |
100 |
0.365 |