Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HWU11_RS00205 Genome accession   NZ_CP058285
Coordinates   37635..37748 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BT302     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32635..42748
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWU11_RS00180 - 32679..34904 (+) 2226 WP_237008485.1 AAA family ATPase -
  HWU11_RS00185 panD 34894..35247 (+) 354 WP_120972089.1 aspartate 1-decarboxylase -
  HWU11_RS00190 - 35250..35552 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  HWU11_RS00195 - 35552..36556 (+) 1005 WP_237008908.1 PDZ domain-containing protein -
  HWU11_RS00200 comB6 36564..37619 (+) 1056 WP_237008486.1 P-type conjugative transfer protein TrbL Machinery gene
  HWU11_RS00205 comB7 37635..37748 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HWU11_RS00210 comB8 37745..38488 (+) 744 WP_237008487.1 type IV secretion system protein Machinery gene
  HWU11_RS00215 comB9 38488..39462 (+) 975 WP_237008488.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWU11_RS00220 comB10 39455..40591 (+) 1137 WP_237008489.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWU11_RS00225 - 40661..42073 (+) 1413 WP_237008490.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=463445 HWU11_RS00205 WP_001217873.1 37635..37748(+) (comB7) [Helicobacter pylori strain BT302]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=463445 HWU11_RS00205 WP_001217873.1 37635..37748(+) (comB7) [Helicobacter pylori strain BT302]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1