Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HWU15_RS00200 Genome accession   NZ_CP058281
Coordinates   37433..37525 (+) Length   30 a.a.
NCBI ID   WP_237015520.1    Uniprot ID   -
Organism   Helicobacter pylori strain Hk711     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 32433..42525
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWU15_RS00175 - 32474..34693 (+) 2220 WP_237015519.1 AAA family ATPase -
  HWU15_RS00180 panD 34683..35033 (+) 351 WP_120935459.1 aspartate 1-decarboxylase -
  HWU15_RS00185 - 35044..35337 (+) 294 WP_000347923.1 YbaB/EbfC family nucleoid-associated protein -
  HWU15_RS00190 - 35337..36332 (+) 996 WP_237016014.1 PDZ domain-containing protein -
  HWU15_RS00195 comB6 36340..37395 (+) 1056 WP_237016015.1 P-type conjugative transfer protein TrbL Machinery gene
  HWU15_RS00200 comB7 37433..37525 (+) 93 WP_237015520.1 comB7 lipoprotein Machinery gene
  HWU15_RS00205 comB8 37522..38259 (+) 738 WP_237015521.1 type IV secretion system protein Machinery gene
  HWU15_RS00210 comB9 38259..39233 (+) 975 WP_237015522.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWU15_RS00215 comB10 39226..40362 (+) 1137 WP_237015523.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWU15_RS00220 - 40433..41845 (+) 1413 WP_237015524.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 30 a.a.        Molecular weight: 3416.11 Da        Isoelectric Point: 8.5423

>NTDB_id=463422 HWU15_RS00200 WP_237015520.1 37433..37525(+) (comB7) [Helicobacter pylori strain Hk711]
MGIMLFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 93 bp        

>NTDB_id=463422 HWU15_RS00200 WP_237015520.1 37433..37525(+) (comB7) [Helicobacter pylori strain Hk711]
ATGGGAATCATGTTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTGCACATTGTATGAAAACAGGTT
AAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

90

100

0.9