Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HWU18_RS00205 Genome accession   NZ_CP058252
Coordinates   36817..36930 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain NP05-124     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 31817..41930
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HWU18_RS00180 - 31873..34098 (+) 2226 WP_237004374.1 AAA family ATPase -
  HWU18_RS00185 panD 34088..34438 (+) 351 WP_000142282.1 aspartate 1-decarboxylase -
  HWU18_RS00190 - 34449..34742 (+) 294 WP_000347921.1 YbaB/EbfC family nucleoid-associated protein -
  HWU18_RS00195 - 34742..35737 (+) 996 WP_237004375.1 PDZ domain-containing protein -
  HWU18_RS00200 comB6 35746..36801 (+) 1056 WP_237004376.1 P-type conjugative transfer protein TrbL Machinery gene
  HWU18_RS00205 comB7 36817..36930 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HWU18_RS00210 comB8 36927..37664 (+) 738 WP_140500962.1 type IV secretion system protein Machinery gene
  HWU18_RS00215 comB9 37664..38629 (+) 966 WP_237004377.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HWU18_RS00220 comB10 38622..39758 (+) 1137 WP_237004378.1 DNA type IV secretion system protein ComB10 Machinery gene
  HWU18_RS00225 - 39828..41246 (+) 1419 WP_237004379.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=463066 HWU18_RS00205 WP_001217873.1 36817..36930(+) (comB7) [Helicobacter pylori strain NP05-124]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=463066 HWU18_RS00205 WP_001217873.1 36817..36930(+) (comB7) [Helicobacter pylori strain NP05-124]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1