Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HV105_RS26055 Genome accession   NZ_CP058118
Coordinates   5421951..5422487 (-) Length   178 a.a.
NCBI ID   WP_016807973.1    Uniprot ID   A0A6L3Y3G1
Organism   Klebsiella michiganensis strain RHBSTW-00167     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 5362171..5434178 5421951..5422487 within 0


Gene organization within MGE regions


Location: 5362171..5434178
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HV105_RS25755 (HV105_25755) - 5362415..5363446 (-) 1032 WP_016807923.1 site-specific integrase -
  HV105_RS25760 (HV105_25760) - 5363507..5365126 (-) 1620 WP_016807924.1 TraI domain-containing protein -
  HV105_RS25765 (HV105_25765) - 5365193..5366701 (-) 1509 WP_029591438.1 UvrD-helicase domain-containing protein -
  HV105_RS25770 (HV105_25770) - 5367012..5368868 (-) 1857 WP_029591439.1 DUF2357 domain-containing protein -
  HV105_RS25775 (HV105_25775) - 5368880..5371438 (-) 2559 WP_181250252.1 AAA family ATPase -
  HV105_RS25780 (HV105_25780) - 5371777..5372709 (-) 933 WP_016807928.1 DUF1281 domain-containing protein -
  HV105_RS25785 (HV105_25785) - 5372815..5373801 (-) 987 WP_016807929.1 ArdC-like ssDNA-binding domain-containing protein -
  HV105_RS25790 (HV105_25790) - 5373883..5374230 (-) 348 WP_016807930.1 hypothetical protein -
  HV105_RS25795 (HV105_25795) - 5374298..5374900 (-) 603 WP_016807931.1 DUF3085 domain-containing protein -
  HV105_RS25800 (HV105_25800) - 5374976..5375623 (-) 648 WP_016807932.1 hypothetical protein -
  HV105_RS25805 (HV105_25805) - 5375708..5376073 (-) 366 WP_016807933.1 hypothetical protein -
  HV105_RS25810 (HV105_25810) - 5376152..5376526 (-) 375 WP_016807934.1 hypothetical protein -
  HV105_RS25815 (HV105_25815) - 5376519..5376887 (-) 369 WP_045282254.1 hypothetical protein -
  HV105_RS25820 (HV105_25820) - 5377291..5377593 (+) 303 WP_016807936.1 PIN domain-containing protein -
  HV105_RS25825 (HV105_25825) - 5377622..5378330 (+) 709 Protein_5102 IS1 family transposase -
  HV105_RS25830 (HV105_25830) - 5378409..5379104 (+) 696 Protein_5103 IS1 family transposase -
  HV105_RS25835 (HV105_25835) - 5379119..5379259 (-) 141 Protein_5104 maltose acetyltransferase domain-containing protein -
  HV105_RS25840 (HV105_25840) lacY 5379343..5380578 (-) 1236 WP_064146656.1 lactose permease -
  HV105_RS25845 (HV105_25845) lacZ 5380630..5383704 (-) 3075 WP_181250253.1 beta-galactosidase -
  HV105_RS25850 (HV105_25850) lacI 5383827..5384909 (-) 1083 WP_024193489.1 DNA-binding transcriptional repressor LacI -
  HV105_RS25855 (HV105_25855) - 5385203..5385409 (+) 207 WP_016809494.1 DUF1471 domain-containing protein -
  HV105_RS25860 (HV105_25860) - 5385919..5386818 (-) 900 WP_026056053.1 integrase domain-containing protein -
  HV105_RS25865 (HV105_25865) - 5388013..5388690 (+) 678 Protein_5110 IS630 family transposase -
  HV105_RS25870 (HV105_25870) - 5388741..5389289 (-) 549 WP_221891797.1 hypothetical protein -
  HV105_RS32335 - 5389501..5389743 (-) 243 WP_323807205.1 DUF4113 domain-containing protein -
  HV105_RS32105 - 5389779..5390321 (-) 543 WP_050547113.1 hypothetical protein -
  HV105_RS25880 (HV105_25880) - 5390375..5391483 (+) 1109 WP_100214960.1 IS3 family transposase -
  HV105_RS25885 (HV105_25885) - 5391835..5392212 (+) 378 WP_016808242.1 hypothetical protein -
  HV105_RS25890 (HV105_25890) - 5392244..5393752 (-) 1509 WP_016808243.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  HV105_RS25895 (HV105_25895) - 5393755..5394093 (-) 339 WP_016808244.1 hypothetical protein -
  HV105_RS25900 (HV105_25900) - 5394104..5395579 (-) 1476 WP_016808245.1 integrating conjugative element protein -
  HV105_RS25905 (HV105_25905) - 5395579..5396571 (-) 993 WP_016808246.1 TIGR03756 family integrating conjugative element protein -
  HV105_RS25910 (HV105_25910) - 5396568..5396966 (-) 399 WP_016808247.1 TIGR03757 family integrating conjugative element protein -
  HV105_RS25915 (HV105_25915) - 5397929..5399233 (-) 1305 WP_016808248.1 restriction endonuclease -
  HV105_RS25920 (HV105_25920) - 5399237..5400376 (-) 1140 WP_016808249.1 AAA family ATPase -
  HV105_RS25925 (HV105_25925) - 5400366..5400938 (-) 573 WP_016808250.1 hypothetical protein -
  HV105_RS25930 (HV105_25930) - 5400931..5403150 (-) 2220 WP_016808251.1 N-6 DNA methylase -
  HV105_RS25935 (HV105_25935) - 5403147..5404241 (-) 1095 WP_016808252.1 DNA adenine methylase -
  HV105_RS25940 (HV105_25940) - 5404933..5405310 (-) 378 WP_016808254.1 hypothetical protein -
  HV105_RS25945 (HV105_25945) - 5405307..5408165 (-) 2859 WP_016808255.1 conjugative transfer ATPase -
  HV105_RS25950 (HV105_25950) - 5408165..5408575 (-) 411 WP_016808256.1 TIGR03751 family conjugal transfer lipoprotein -
  HV105_RS25955 (HV105_25955) - 5408575..5408943 (-) 369 WP_016151320.1 hypothetical protein -
  HV105_RS25960 (HV105_25960) - 5408954..5410456 (-) 1503 WP_016808257.1 TIGR03752 family integrating conjugative element protein -
  HV105_RS25965 (HV105_25965) - 5410446..5411396 (-) 951 WP_016808258.1 TIGR03749 family integrating conjugative element protein -
  HV105_RS25970 (HV105_25970) - 5411396..5412055 (-) 660 WP_016808259.1 TIGR03746 family integrating conjugative element protein -
  HV105_RS25975 (HV105_25975) - 5412052..5412408 (-) 357 WP_004115534.1 TIGR03750 family conjugal transfer protein -
  HV105_RS25980 (HV105_25980) - 5412421..5412807 (-) 387 WP_016808260.1 TIGR03745 family integrating conjugative element membrane protein -
  HV105_RS25985 (HV105_25985) - 5412842..5413084 (-) 243 WP_003029734.1 TIGR03758 family integrating conjugative element protein -
  HV105_RS25990 (HV105_25990) - 5413084..5413431 (-) 348 WP_016808261.1 RAQPRD family integrative conjugative element protein -
  HV105_RS25995 (HV105_25995) - 5413616..5413963 (+) 348 WP_016808262.1 FxLYD domain-containing protein -
  HV105_RS26000 (HV105_26000) - 5414054..5414812 (-) 759 WP_006785966.1 TIGR03747 family integrating conjugative element membrane protein -
  HV105_RS26005 (HV105_26005) traD 5414805..5416904 (-) 2100 WP_016808263.1 type IV conjugative transfer system coupling protein TraD -
  HV105_RS26010 (HV105_26010) - 5416897..5417385 (-) 489 WP_016808264.1 hypothetical protein -
  HV105_RS26015 (HV105_26015) - 5417396..5417968 (-) 573 WP_017145109.1 restriction endonuclease -
  HV105_RS26020 (HV105_26020) - 5417968..5418501 (-) 534 WP_016807967.1 integrating conjugative element protein -
  HV105_RS26025 (HV105_26025) - 5418507..5419142 (-) 636 WP_088221852.1 transglycosylase SLT domain-containing protein -
  HV105_RS26030 (HV105_26030) - 5419121..5419843 (-) 723 WP_016807969.1 TIGR03759 family integrating conjugative element protein -
  HV105_RS26035 (HV105_26035) - 5419855..5420613 (-) 759 WP_016807970.1 hypothetical protein -
  HV105_RS26040 (HV105_26040) - 5420610..5421275 (-) 666 WP_016807971.1 PilL N-terminal domain-containing protein -
  HV105_RS26045 (HV105_26045) - 5421412..5421660 (-) 249 WP_004115558.1 DUF2442 domain-containing protein -
  HV105_RS26050 (HV105_26050) - 5421644..5421886 (-) 243 WP_016807972.1 DUF4160 domain-containing protein -
  HV105_RS26055 (HV105_26055) ssb 5421951..5422487 (-) 537 WP_016807973.1 single-stranded DNA-binding protein Machinery gene
  HV105_RS26060 (HV105_26060) - 5422548..5423018 (-) 471 WP_016807974.1 STY4534 family ICE replication protein -
  HV105_RS26065 (HV105_26065) - 5423654..5425663 (-) 2010 WP_016807975.1 DNA topoisomerase III -
  HV105_RS26070 (HV105_26070) - 5425679..5426233 (-) 555 WP_016807976.1 hypothetical protein -
  HV105_RS26075 (HV105_26075) - 5426235..5426960 (-) 726 WP_016807977.1 TIGR03761 family integrating conjugative element protein -
  HV105_RS26080 (HV105_26080) - 5427029..5427265 (+) 237 WP_134892789.1 hypothetical protein -
  HV105_RS26085 (HV105_26085) - 5427252..5428490 (-) 1239 WP_016807978.1 STY4528 family pathogenicity island replication protein -
  HV105_RS26090 (HV105_26090) - 5428590..5428838 (-) 249 WP_004115572.1 hypothetical protein -
  HV105_RS26095 (HV105_26095) - 5428835..5429425 (-) 591 WP_006777722.1 DUF2857 domain-containing protein -
  HV105_RS26100 (HV105_26100) - 5429432..5430142 (-) 711 WP_016807979.1 DUF2786 domain-containing protein -
  HV105_RS26105 (HV105_26105) - 5430135..5431835 (-) 1701 WP_016807980.1 ParB family protein -
  HV105_RS26110 (HV105_26110) dnaB-PI 5431832..5433202 (-) 1371 WP_004115579.1 SPI-7-type island replicative DNA helicase -
  HV105_RS26115 (HV105_26115) - 5433195..5434070 (-) 876 WP_016807981.1 ParA family protein -

Sequence


Protein


Download         Length: 178 a.a.        Molecular weight: 19182.31 Da        Isoelectric Point: 6.7299

>NTDB_id=462256 HV105_RS26055 WP_016807973.1 5421951..5422487(-) (ssb) [Klebsiella michiganensis strain RHBSTW-00167]
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYLRKGSQVYI
EGQLRTRKWTDQSGQEKYITEVVVNIGGTMQMLGGRQSGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDD
IPFIGFGYGVPKSAIHAL

Nucleotide


Download         Length: 537 bp        

>NTDB_id=462256 HV105_RS26055 WP_016807973.1 5421951..5422487(-) (ssb) [Klebsiella michiganensis strain RHBSTW-00167]
ATGTCCTCACGCGGCGTTAACAAGGTGATTCTTGTCGGTAATCTCGGCCAGGATCCTGAAGTGCGTTATATTCCCAATGG
CAGTGCAGTTGCCACCCTTTCTCTGGCCACGTCTGAGAGCTGGCGTGATAAGCAGTCCGGTGAACAGAAAGAAGTGACCG
AATGGCACCGGGTGGTTATTTTCGGCAAGCTGGCAGAAATTGCGGGTGAATATCTGCGCAAAGGCTCCCAGGTTTACATC
GAGGGCCAGCTGCGCACACGCAAATGGACCGATCAGTCTGGCCAGGAGAAATACATCACAGAGGTGGTGGTAAACATTGG
TGGCACCATGCAGATGCTTGGCGGTCGCCAGTCCGGCAGCGGTCAGAATACGTCTTCCCGGAATGACTGGGGCCAGCCTC
AGCAACCTTCCGGACCGACTCACAGTGGCCAGGCTTCCGGCAGCAGTGCCGGTGCGCCACCGATGGACTTCGATGACGAT
ATACCGTTCATTGGATTCGGGTATGGAGTACCAAAATCGGCAATCCATGCACTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A6L3Y3G1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

64.407

99.438

0.64

  ssb Glaesserella parasuis strain SC1401

49.171

100

0.5

  ssb Neisseria meningitidis MC58

44.633

99.438

0.444

  ssb Neisseria gonorrhoeae MS11

44.318

98.876

0.438