Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HV236_RS05560 Genome accession   NZ_CP056707
Coordinates   1155910..1156404 (-) Length   164 a.a.
NCBI ID   WP_063153802.1    Uniprot ID   -
Organism   Enterobacter hormaechei strain RHBSTW-00564     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1149370..1208008 1155910..1156404 within 0


Gene organization within MGE regions


Location: 1149370..1208008
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HV236_RS23435 - 1149370..1150527 (-) 1158 WP_223831790.1 site-specific integrase -
  HV236_RS05510 (HV236_05520) - 1150410..1150745 (-) 336 WP_071886183.1 helix-turn-helix domain-containing protein -
  HV236_RS05515 (HV236_05525) - 1150852..1151154 (-) 303 WP_059290846.1 hypothetical protein -
  HV236_RS05520 (HV236_05530) - 1151164..1151403 (-) 240 WP_063159396.1 DUF4222 domain-containing protein -
  HV236_RS05525 (HV236_05535) - 1151366..1151953 (-) 588 WP_063159395.1 hypothetical protein -
  HV236_RS05530 (HV236_05540) - 1151950..1152171 (-) 222 WP_053087062.1 TraR/DksA family transcriptional regulator -
  HV236_RS05535 (HV236_05545) - 1152438..1152785 (-) 348 WP_023303576.1 hypothetical protein -
  HV236_RS05540 (HV236_05550) - 1152782..1153000 (-) 219 WP_023300422.1 hypothetical protein -
  HV236_RS05545 (HV236_05555) - 1153003..1155225 (-) 2223 WP_063159394.1 Dam family site-specific DNA-(adenine-N6)-methyltransferase -
  HV236_RS05550 (HV236_05560) - 1155222..1155374 (-) 153 WP_063153804.1 DUF1317 family protein -
  HV236_RS05555 (HV236_05565) - 1155374..1155703 (-) 330 WP_063153803.1 hypothetical protein -
  HV236_RS05560 (HV236_05570) ssb 1155910..1156404 (-) 495 WP_063153802.1 single-stranded DNA-binding protein Machinery gene
  HV236_RS05565 (HV236_05575) - 1156405..1157130 (-) 726 WP_063153801.1 Rad52/Rad22 family DNA repair protein -
  HV236_RS05570 (HV236_05580) - 1157127..1157285 (-) 159 WP_159424631.1 hypothetical protein -
  HV236_RS05575 (HV236_05585) - 1157282..1157479 (-) 198 WP_032667076.1 hypothetical protein -
  HV236_RS05580 (HV236_05590) - 1157488..1158456 (-) 969 WP_181522261.1 hypothetical protein -
  HV236_RS05585 (HV236_05595) - 1158525..1158665 (-) 141 WP_023327239.1 host cell division inhibitory peptide Kil -
  HV236_RS05590 (HV236_05600) - 1158662..1158820 (-) 159 WP_063132389.1 hypothetical protein -
  HV236_RS05600 (HV236_05610) - 1160231..1160398 (-) 168 WP_181522262.1 hypothetical protein -
  HV236_RS05610 (HV236_05620) - 1162035..1162424 (+) 390 WP_181522281.1 hypothetical protein -
  HV236_RS05615 (HV236_05625) - 1162815..1163246 (+) 432 WP_063153807.1 recombination protein NinB -
  HV236_RS05620 (HV236_05630) - 1163239..1163820 (+) 582 WP_052687539.1 NUMOD4 domain-containing protein -
  HV236_RS05625 (HV236_05635) - 1163820..1163990 (+) 171 WP_023296423.1 NinE family protein -
  HV236_RS05630 (HV236_05640) - 1163983..1164624 (+) 642 WP_063863271.1 recombination protein NinG -
  HV236_RS05640 (HV236_05650) - 1164824..1164940 (+) 117 WP_102046759.1 hypothetical protein -
  HV236_RS05645 (HV236_05655) - 1164937..1165626 (+) 690 WP_063160440.1 bacteriophage antitermination protein Q -
  HV236_RS05650 (HV236_05660) - 1166119..1166343 (+) 225 WP_023622516.1 class II holin family protein -
  HV236_RS05655 (HV236_05665) - 1166321..1166815 (+) 495 WP_058689315.1 lysozyme -
  HV236_RS05660 (HV236_05670) - 1166812..1167114 (+) 303 WP_058689314.1 hypothetical protein -
  HV236_RS05665 (HV236_05675) - 1167111..1167572 (+) 462 WP_058689313.1 lysis protein -
  HV236_RS05670 (HV236_05680) - 1167978..1168169 (+) 192 WP_063863319.1 hypothetical protein -
  HV236_RS05675 (HV236_05685) - 1168188..1168703 (+) 516 WP_063159386.1 hypothetical protein -
  HV236_RS05680 (HV236_05690) - 1168703..1170175 (+) 1473 WP_063159385.1 hypothetical protein -
  HV236_RS05685 (HV236_05695) - 1170187..1171647 (+) 1461 WP_063159384.1 phage portal protein -
  HV236_RS05690 (HV236_05700) - 1171601..1172584 (+) 984 WP_169815507.1 phage minor head protein -
  HV236_RS05695 (HV236_05705) - 1172624..1173139 (+) 516 WP_053265478.1 hypothetical protein -
  HV236_RS05700 (HV236_05710) - 1173209..1174594 (+) 1386 WP_063159382.1 DUF2213 domain-containing protein -
  HV236_RS05705 (HV236_05715) - 1174598..1175038 (+) 441 WP_063159381.1 hypothetical protein -
  HV236_RS05710 (HV236_05720) - 1175050..1176126 (+) 1077 WP_063159380.1 major capsid protein -
  HV236_RS05715 (HV236_05725) - 1176137..1176538 (+) 402 WP_063159379.1 hypothetical protein -
  HV236_RS05720 (HV236_05730) - 1176541..1176921 (+) 381 WP_057072451.1 hypothetical protein -
  HV236_RS05725 (HV236_05735) - 1176921..1177094 (+) 174 WP_045911060.1 hypothetical protein -
  HV236_RS05730 (HV236_05740) - 1177094..1177450 (+) 357 WP_023300379.1 hypothetical protein -
  HV236_RS05735 (HV236_05745) - 1177453..1177917 (+) 465 WP_049024550.1 hypothetical protein -
  HV236_RS05740 (HV236_05750) - 1177914..1178297 (+) 384 WP_032608745.1 hypothetical protein -
  HV236_RS05745 (HV236_05755) - 1178361..1179104 (+) 744 WP_006808946.1 Ig-like domain-containing protein -
  HV236_RS05750 (HV236_05760) - 1179162..1179833 (+) 672 WP_058685502.1 DUF6246 family protein -
  HV236_RS05755 (HV236_05765) - 1179846..1182791 (+) 2946 WP_063159378.1 tail protein (tape measure) -
  HV236_RS05760 (HV236_05770) - 1182791..1183288 (+) 498 WP_063159377.1 hypothetical protein -
  HV236_RS05765 (HV236_05775) - 1183288..1183758 (+) 471 WP_048981791.1 hypothetical protein -
  HV236_RS05770 (HV236_05780) - 1183772..1184137 (+) 366 WP_063159376.1 NlpC/P60 family protein -
  HV236_RS05775 (HV236_05785) - 1184124..1186601 (+) 2478 WP_063159375.1 host specificity factor TipJ family phage tail protein -
  HV236_RS23440 - 1186660..1189032 (+) 2373 WP_063159374.1 SGNH/GDSL hydrolase family protein -
  HV236_RS05785 (HV236_05795) - 1189131..1190564 (-) 1434 WP_072051099.1 glucosyltransferase domain-containing protein -
  HV236_RS05790 (HV236_05800) - 1190561..1191478 (-) 918 WP_045332447.1 glycosyltransferase family 2 protein -
  HV236_RS05795 (HV236_05805) - 1191475..1191837 (-) 363 WP_045332444.1 GtrA family protein -
  HV236_RS23370 - 1191951..1192316 (+) 366 WP_047722008.1 S24 family peptidase -
  HV236_RS05800 (HV236_05810) yahO 1192791..1193066 (+) 276 WP_045334432.1 DUF1471 family periplasmic protein YahO -
  HV236_RS05805 (HV236_05815) - 1193268..1195451 (+) 2184 WP_047052849.1 TonB-dependent siderophore receptor -
  HV236_RS05810 (HV236_05820) - 1195579..1197552 (+) 1974 WP_047052851.1 PhoX family phosphatase -
  HV236_RS05815 (HV236_05825) pheP 1197655..1199040 (+) 1386 WP_047052853.1 phenylalanine transporter -
  HV236_RS05820 (HV236_05830) - 1199301..1200536 (+) 1236 WP_047052854.1 MFS transporter -
  HV236_RS05825 (HV236_05835) - 1200552..1201577 (+) 1026 WP_047052856.1 sugar phosphate isomerase/epimerase -
  HV236_RS05830 (HV236_05840) - 1201570..1202712 (+) 1143 WP_047052859.1 Gfo/Idh/MocA family oxidoreductase -
  HV236_RS05835 (HV236_05845) - 1202788..1203759 (+) 972 WP_047052861.1 LacI family DNA-binding transcriptional regulator -
  HV236_RS05840 (HV236_05850) - 1203760..1205004 (-) 1245 WP_022650531.1 mechanosensitive ion channel family protein -
  HV236_RS05845 (HV236_05855) - 1205072..1206508 (-) 1437 WP_039271415.1 MFS transporter -
  HV236_RS05850 (HV236_05860) - 1206616..1207485 (+) 870 WP_017382554.1 helix-turn-helix transcriptional regulator -
  HV236_RS05855 (HV236_05870) - 1207721..1208008 (+) 288 WP_015571209.1 helix-turn-helix transcriptional regulator -

Sequence


Protein


Download         Length: 164 a.a.        Molecular weight: 17468.46 Da        Isoelectric Point: 5.7670

>NTDB_id=460253 HV236_RS05560 WP_063153802.1 1155910..1156404(-) (ssb) [Enterobacter hormaechei strain RHBSTW-00564]
MAKGINKVILVGNLGQDPEVRYLPSGGAVCSLTLATSESWRDKATGELKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIE
GQLRTRKWTDQAGTEKYTTEVVVNVGGTMQMLGGRQGGGAAPAGGSPAQGGNQFSGGAQSRAQQHSTPAQSNEPPMDFDD
DIPF

Nucleotide


Download         Length: 495 bp        

>NTDB_id=460253 HV236_RS05560 WP_063153802.1 1155910..1156404(-) (ssb) [Enterobacter hormaechei strain RHBSTW-00564]
ATGGCAAAGGGCATCAACAAAGTGATCCTCGTCGGCAACCTCGGGCAAGACCCCGAGGTCCGTTATCTTCCCTCCGGCGG
CGCAGTGTGCAGCCTTACACTGGCGACATCGGAGTCATGGCGAGATAAAGCCACTGGCGAGCTCAAAGAGCAAACGGAAT
GGCACCGCGTCGTTCTGTTCGGAAAACTGGCAGAAGTGGCCGGTGAATACCTGCGCAAAGGTTCTCAGGTCTATATCGAG
GGGCAACTGCGCACCCGCAAATGGACAGATCAGGCAGGTACCGAGAAGTACACCACTGAGGTAGTGGTAAACGTCGGCGG
CACAATGCAGATGCTTGGTGGCCGTCAGGGCGGTGGAGCGGCACCGGCAGGTGGCAGCCCGGCGCAGGGCGGGAATCAGT
TCAGCGGCGGCGCACAGTCTCGCGCACAGCAGCACTCGACACCCGCCCAATCTAACGAACCGCCAATGGACTTCGACGAC
GATATACCTTTTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

67.045

100

0.72

  ssb Glaesserella parasuis strain SC1401

53.591

100

0.591

  ssb Neisseria meningitidis MC58

43.75

100

0.47

  ssb Neisseria gonorrhoeae MS11

43.75

100

0.47