Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HV276_RS14745 Genome accession   NZ_CP056165
Coordinates   2997418..2997933 (+) Length   171 a.a.
NCBI ID   WP_000168264.1    Uniprot ID   A0A7L5X6G7
Organism   Escherichia marmotae strain RHBSTW-00777     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2959174..3003203 2997418..2997933 within 0


Gene organization within MGE regions


Location: 2959174..3003203
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HV276_RS14465 (HV276_14470) - 2959174..2961114 (-) 1941 WP_016248905.1 helix-hairpin-helix domain-containing protein -
  HV276_RS14470 (HV276_14475) - 2961111..2961872 (-) 762 WP_105224971.1 PP2C family serine/threonine-protein phosphatase -
  HV276_RS14475 (HV276_14480) - 2961869..2962528 (-) 660 WP_000003146.1 vWA domain-containing protein -
  HV276_RS14480 (HV276_14485) - 2962746..2962802 (-) 57 WP_106907789.1 type I toxin-antitoxin system Ibs family toxin -
  HV276_RS24120 - 2963032..2963136 (+) 105 Protein_2879 hypothetical protein -
  HV276_RS14485 (HV276_14490) - 2963266..2963628 (+) 363 WP_105288867.1 bactoprenol glucosyl transferase -
  HV276_RS14490 (HV276_14495) - 2963625..2964551 (+) 927 WP_105288868.1 glycosyltransferase family 2 protein -
  HV276_RS14495 (HV276_14500) - 2964541..2966013 (+) 1473 WP_105288869.1 glucosyltransferase domain-containing protein -
  HV276_RS24125 - 2966083..2967858 (-) 1776 WP_228929179.1 phage head-binding domain-containing protein -
  HV276_RS14505 (HV276_14510) - 2968023..2970020 (-) 1998 WP_105288870.1 DNA transfer protein -
  HV276_RS14510 (HV276_14515) - 2970020..2971324 (-) 1305 WP_105288871.1 DNA transfer protein -
  HV276_RS14515 (HV276_14520) - 2971334..2972029 (-) 696 WP_021516147.1 hypothetical protein -
  HV276_RS14520 (HV276_14525) - 2972032..2972487 (-) 456 WP_021516148.1 DUF2824 family protein -
  HV276_RS14525 (HV276_14530) - 2972487..2973188 (-) 702 WP_021823762.1 hypothetical protein -
  HV276_RS14530 (HV276_14535) - 2973188..2974606 (-) 1419 WP_001122392.1 packaged DNA stabilization protein gp10 -
  HV276_RS14535 (HV276_14540) - 2974616..2975077 (-) 462 WP_047089868.1 packaged DNA stabilization gp4 family protein -
  HV276_RS14540 (HV276_14545) - 2975058..2975246 (-) 189 WP_001362792.1 hypothetical protein -
  HV276_RS14545 (HV276_14550) - 2975288..2976541 (-) 1254 WP_105288964.1 P22 phage major capsid protein family protein -
  HV276_RS14550 (HV276_14555) - 2976560..2977453 (-) 894 WP_115775507.1 scaffolding protein -
  HV276_RS14555 (HV276_14560) - 2977544..2979742 (-) 2199 WP_000818368.1 portal protein -
  HV276_RS14560 (HV276_14565) - 2979744..2981159 (-) 1416 WP_105288930.1 PBSX family phage terminase large subunit -
  HV276_RS14565 (HV276_14570) - 2981156..2981683 (-) 528 WP_089602606.1 terminase small subunit -
  HV276_RS14570 (HV276_14575) - 2981705..2981950 (+) 246 WP_001228633.1 hypothetical protein -
  HV276_RS14575 (HV276_14580) - 2981947..2982852 (+) 906 WP_001544378.1 LPO_1073/Vpar_1526 family protein -
  HV276_RS23855 - 2982950..2983156 (-) 207 Protein_2899 hypothetical protein -
  HV276_RS14580 (HV276_14585) - 2983210..2983470 (+) 261 WP_000093956.1 hypothetical protein -
  HV276_RS14585 (HV276_14590) - 2983537..2984061 (-) 525 WP_001064346.1 Rha family transcriptional regulator -
  HV276_RS14590 (HV276_14595) - 2984265..2984417 (-) 153 WP_001544376.1 hypothetical protein -
  HV276_RS14595 (HV276_14600) - 2984405..2984872 (-) 468 WP_089571404.1 lysis protein -
  HV276_RS14600 (HV276_14605) - 2984869..2985345 (-) 477 WP_000229392.1 glycoside hydrolase family protein -
  HV276_RS14605 (HV276_14610) - 2985329..2985652 (-) 324 WP_000783734.1 phage holin, lambda family -
  HV276_RS14620 (HV276_14625) - 2986114..2986632 (-) 519 WP_105279761.1 antiterminator Q family protein -
  HV276_RS14625 (HV276_14630) - 2986629..2986817 (-) 189 WP_000994516.1 protein ninH -
  HV276_RS14630 (HV276_14635) - 2986814..2987176 (-) 363 WP_001008200.1 RusA family crossover junction endodeoxyribonuclease -
  HV276_RS14635 (HV276_14640) - 2987173..2987463 (-) 291 WP_000002244.1 DUF1364 domain-containing protein -
  HV276_RS14640 (HV276_14645) - 2987463..2987732 (-) 270 WP_021516158.1 hypothetical protein -
  HV276_RS14645 (HV276_14650) - 2987725..2987895 (-) 171 WP_000566866.1 protein NinF -
  HV276_RS14650 (HV276_14655) - 2987892..2988074 (-) 183 WP_024189304.1 NinE family protein -
  HV276_RS14655 (HV276_14660) ninD 2988041..2988214 (-) 174 WP_000984218.1 protein NinD -
  HV276_RS14660 (HV276_14665) - 2988211..2989083 (-) 873 WP_162826122.1 phosphoadenosine phosphosulfate reductase family protein -
  HV276_RS14665 (HV276_14670) - 2989080..2989520 (-) 441 WP_115775509.1 recombination protein NinB -
  HV276_RS14670 (HV276_14675) - 2989734..2990060 (-) 327 WP_000796283.1 hypothetical protein -
  HV276_RS14675 (HV276_14680) - 2990133..2991509 (-) 1377 WP_001248388.1 replicative DNA helicase -
  HV276_RS14680 (HV276_14685) - 2991506..2992327 (-) 822 WP_181502868.1 replication protein -
  HV276_RS14685 (HV276_14690) - 2992314..2992475 (-) 162 WP_000166961.1 hypothetical protein -
  HV276_RS14690 (HV276_14695) - 2992510..2992788 (-) 279 WP_000424164.1 lambda phage CII family protein -
  HV276_RS14695 (HV276_14700) - 2992897..2993091 (-) 195 WP_000620665.1 Cro/CI family transcriptional regulator -
  HV276_RS14700 (HV276_14705) - 2993198..2993914 (+) 717 WP_000428318.1 LexA family protein -
  HV276_RS14705 (HV276_14710) - 2993932..2994300 (+) 369 WP_105288934.1 hypothetical protein -
  HV276_RS14710 (HV276_14715) - 2994668..2994967 (+) 300 WP_069924756.1 hypothetical protein -
  HV276_RS14715 (HV276_14720) - 2995046..2995246 (+) 201 WP_000213975.1 antirestriction Ral family protein -
  HV276_RS14720 (HV276_14725) - 2995274..2995516 (+) 243 WP_105288933.1 DUF7446 family protein -
  HV276_RS14725 (HV276_14730) - 2995684..2996100 (+) 417 WP_105288937.1 hypothetical protein -
  HV276_RS14730 (HV276_14735) - 2996184..2996318 (+) 135 WP_000972063.1 hypothetical protein -
  HV276_RS14735 (HV276_14740) kil 2996303..2996455 (+) 153 WP_001243355.1 host cell division inhibitory peptide Kil -
  HV276_RS14740 (HV276_14745) - 2996710..2997417 (+) 708 WP_044865624.1 Rad52/Rad22 family DNA repair protein -
  HV276_RS14745 (HV276_14750) ssb 2997418..2997933 (+) 516 WP_000168264.1 single-stranded DNA-binding protein Machinery gene
  HV276_RS14750 (HV276_14755) - 2997942..2998490 (+) 549 WP_016248935.1 3'-5' exonuclease -
  HV276_RS14755 (HV276_14760) - 2998507..2998800 (+) 294 WP_064529150.1 phage anti-RecBCD protein -
  HV276_RS14760 (HV276_14765) - 2998820..2999101 (+) 282 WP_000773121.1 DUF5405 family protein -
  HV276_RS14765 (HV276_14770) - 2999098..2999262 (+) 165 WP_105288956.1 DUF2737 family protein -
  HV276_RS14770 (HV276_14775) - 2999259..2999858 (+) 600 WP_105288957.1 hypothetical protein -
  HV276_RS24545 (HV276_14780) - 2999855..3000754 (+) 900 WP_411161990.1 ead/Ea22-like family protein -
  HV276_RS24550 (HV276_14785) - 3000751..3001377 (+) 627 WP_220131391.1 DUF551 domain-containing protein -
  HV276_RS23860 - 3001370..3001654 (+) 285 WP_105287482.1 ASCH domain-containing protein -
  HV276_RS14785 (HV276_14790) - 3001727..3001894 (+) 168 WP_032352680.1 hypothetical protein -
  HV276_RS14790 (HV276_14795) - 3001934..3002152 (+) 219 WP_001303849.1 excisionase -
  HV276_RS14795 (HV276_14800) - 3002130..3003203 (+) 1074 WP_061360905.1 tyrosine-type recombinase/integrase -

Sequence


Protein


Download         Length: 171 a.a.        Molecular weight: 19154.34 Da        Isoelectric Point: 7.4686

>NTDB_id=458513 HV276_RS14745 WP_000168264.1 2997418..2997933(+) (ssb) [Escherichia marmotae strain RHBSTW-00777]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMDFDDDIPFAPVT
LPFPRHAIHAI

Nucleotide


Download         Length: 516 bp        

>NTDB_id=458513 HV276_RS14745 WP_000168264.1 2997418..2997933(+) (ssb) [Escherichia marmotae strain RHBSTW-00777]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGTCACGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTAGCAGAAATTGCCAGCGAGTATCTGCGAAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGCGGACAGGATCGGTTCACTACCGAAGTCATCGTGGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAACGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAAGGGAATCACAGCGAACCACCTATGGATTTTGACGACGATATCCCCTTTGCACCAGTAACT
CTCCCCTTCCCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A7L5X6G7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.712

100

0.649

  ssb Glaesserella parasuis strain SC1401

52.486

100

0.556

  ssb Neisseria gonorrhoeae MS11

42.045

100

0.433

  ssb Neisseria meningitidis MC58

41.477

100

0.427