Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HV306_RS04240 | Genome accession | NZ_CP055309 |
| Coordinates | 864249..864740 (+) | Length | 163 a.a. |
| NCBI ID | WP_181247627.1 | Uniprot ID | - |
| Organism | Klebsiella grimontii strain RHBSTW-00866 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 852561..915728 | 864249..864740 | within | 0 |
Gene organization within MGE regions
Location: 852561..915728
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV306_RS04180 (HV306_04180) | - | 852669..853544 (+) | 876 | WP_045282279.1 | ParA family protein | - |
| HV306_RS04185 (HV306_04185) | dnaB-PI | 853537..854907 (+) | 1371 | WP_039187765.1 | SPI-7-type island replicative DNA helicase | - |
| HV306_RS04190 (HV306_04190) | - | 854904..856604 (+) | 1701 | WP_039187764.1 | ParB family protein | - |
| HV306_RS04195 (HV306_04195) | - | 856597..857307 (+) | 711 | WP_045282280.1 | DUF2786 domain-containing protein | - |
| HV306_RS04200 (HV306_04200) | - | 857317..857904 (+) | 588 | WP_020899225.1 | DUF2857 domain-containing protein | - |
| HV306_RS04205 (HV306_04205) | - | 857901..858149 (+) | 249 | WP_004115572.1 | hypothetical protein | - |
| HV306_RS04210 (HV306_04210) | - | 858249..859487 (+) | 1239 | WP_045282281.1 | STY4528 family pathogenicity island replication protein | - |
| HV306_RS04215 (HV306_04215) | - | 859500..859709 (-) | 210 | WP_127791593.1 | hypothetical protein | - |
| HV306_RS04220 (HV306_04220) | - | 859778..860503 (+) | 726 | WP_045282282.1 | PFL_4669 family integrating conjugative element protein | - |
| HV306_RS04225 (HV306_04225) | - | 860505..861059 (+) | 555 | WP_045282283.1 | hypothetical protein | - |
| HV306_RS04230 (HV306_04230) | - | 861075..863084 (+) | 2010 | WP_181247492.1 | DNA topoisomerase III | - |
| HV306_RS04235 (HV306_04235) | - | 863720..864190 (+) | 471 | WP_016807974.1 | STY4534 family ICE replication protein | - |
| HV306_RS04240 (HV306_04240) | ssb | 864249..864740 (+) | 492 | WP_181247627.1 | single-stranded DNA-binding protein | Machinery gene |
| HV306_RS04245 (HV306_04245) | - | 864899..866146 (+) | 1248 | WP_032148592.1 | tyrosine-type recombinase/integrase | - |
| HV306_RS04250 (HV306_04250) | - | 866136..867695 (+) | 1560 | WP_001548010.1 | site-specific integrase | - |
| HV306_RS04255 (HV306_04255) | - | 867688..869721 (+) | 2034 | WP_181247479.1 | integrase | - |
| HV306_RS04260 (HV306_04260) | - | 869714..870133 (+) | 420 | WP_032148671.1 | hypothetical protein | - |
| HV306_RS04265 (HV306_04265) | avs4 | 870209..874969 (+) | 4761 | WP_001548013.1 | AVAST type 4 anti-phage nuclease Avs4 | - |
| HV306_RS04270 (HV306_04270) | - | 875366..876397 (-) | 1032 | WP_001395480.1 | IS630-like element ISEc33 family transposase | - |
| HV306_RS04275 (HV306_04275) | - | 876687..877807 (+) | 1121 | WP_181247428.1 | IS3 family transposase | - |
| HV306_RS04280 (HV306_04280) | - | 877942..878187 (+) | 246 | WP_001548021.1 | hypothetical protein | - |
| HV306_RS04285 (HV306_04285) | - | 878495..878737 (+) | 243 | WP_045282286.1 | DUF4160 domain-containing protein | - |
| HV306_RS04290 (HV306_04290) | - | 878721..878969 (+) | 249 | WP_004115558.1 | DUF2442 domain-containing protein | - |
| HV306_RS04295 (HV306_04295) | - | 879106..879771 (+) | 666 | WP_045282287.1 | PilL N-terminal domain-containing protein | - |
| HV306_RS04300 (HV306_04300) | - | 879768..880526 (+) | 759 | WP_045282288.1 | hypothetical protein | - |
| HV306_RS04305 (HV306_04305) | - | 880538..881260 (+) | 723 | WP_045282289.1 | TIGR03759 family integrating conjugative element protein | - |
| HV306_RS04310 (HV306_04310) | - | 881239..881874 (+) | 636 | WP_045282290.1 | lytic transglycosylase domain-containing protein | - |
| HV306_RS04315 (HV306_04315) | - | 881880..882413 (+) | 534 | WP_045282291.1 | integrating conjugative element protein | - |
| HV306_RS04320 (HV306_04320) | - | 882413..882985 (+) | 573 | WP_039187762.1 | restriction endonuclease | - |
| HV306_RS04325 (HV306_04325) | - | 882996..883484 (+) | 489 | WP_039187761.1 | hypothetical protein | - |
| HV306_RS04330 (HV306_04330) | traD | 883477..885576 (+) | 2100 | WP_039187760.1 | type IV conjugative transfer system coupling protein TraD | - |
| HV306_RS04335 (HV306_04335) | - | 885569..886327 (+) | 759 | WP_045282293.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| HV306_RS04340 (HV306_04340) | - | 886590..887600 (-) | 1011 | WP_045282294.1 | IS110 family transposase | - |
| HV306_RS33265 | - | 888035..888259 (+) | 225 | WP_001243773.1 | IS1-like element transposase | - |
| HV306_RS33270 | - | 888304..888647 (+) | 344 | Protein_863 | IS1 family transposase | - |
| HV306_RS04350 (HV306_04350) | - | 888846..889298 (+) | 453 | WP_059287947.1 | hypothetical protein | - |
| HV306_RS04355 (HV306_04355) | - | 889594..890148 (+) | 555 | WP_045282315.1 | AAA family ATPase | - |
| HV306_RS04360 (HV306_04360) | - | 890535..890882 (+) | 348 | WP_045282314.1 | RAQPRD family integrative conjugative element protein | - |
| HV306_RS04365 (HV306_04365) | - | 890882..891124 (+) | 243 | WP_003029734.1 | TIGR03758 family integrating conjugative element protein | - |
| HV306_RS04370 (HV306_04370) | - | 891159..891545 (+) | 387 | WP_016808260.1 | TIGR03745 family integrating conjugative element membrane protein | - |
| HV306_RS04375 (HV306_04375) | - | 891558..891914 (+) | 357 | WP_045282313.1 | TIGR03750 family conjugal transfer protein | - |
| HV306_RS04380 (HV306_04380) | - | 891911..892570 (+) | 660 | WP_045282312.1 | PFL_4703 family integrating conjugative element protein | - |
| HV306_RS04385 (HV306_04385) | - | 892570..893520 (+) | 951 | WP_045282311.1 | TIGR03749 family integrating conjugative element protein | - |
| HV306_RS04390 (HV306_04390) | - | 893510..895009 (+) | 1500 | WP_039187759.1 | TIGR03752 family integrating conjugative element protein | - |
| HV306_RS04395 (HV306_04395) | - | 895020..895388 (+) | 369 | WP_039187758.1 | hypothetical protein | - |
| HV306_RS04400 (HV306_04400) | - | 895388..895798 (+) | 411 | WP_006785978.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| HV306_RS04405 (HV306_04405) | - | 895798..898656 (+) | 2859 | WP_050310924.1 | conjugative transfer ATPase | - |
| HV306_RS04410 (HV306_04410) | - | 898653..899030 (+) | 378 | WP_039187756.1 | hypothetical protein | - |
| HV306_RS04415 (HV306_04415) | - | 899187..899855 (+) | 669 | WP_039187755.1 | HNH endonuclease signature motif containing protein | - |
| HV306_RS04420 (HV306_04420) | - | 899848..900255 (+) | 408 | WP_048797723.1 | hypothetical protein | - |
| HV306_RS04425 (HV306_04425) | - | 900320..900505 (+) | 186 | WP_135711188.1 | hypothetical protein | - |
| HV306_RS04430 (HV306_04430) | - | 900699..901097 (+) | 399 | WP_039187753.1 | TIGR03757 family integrating conjugative element protein | - |
| HV306_RS04435 (HV306_04435) | - | 901094..902086 (+) | 993 | WP_039187752.1 | TIGR03756 family integrating conjugative element protein | - |
| HV306_RS04440 (HV306_04440) | - | 902086..903561 (+) | 1476 | WP_045282309.1 | integrating conjugative element protein | - |
| HV306_RS04445 (HV306_04445) | - | 903572..903910 (+) | 339 | WP_039187750.1 | hypothetical protein | - |
| HV306_RS04450 (HV306_04450) | - | 903913..905436 (+) | 1524 | WP_039187749.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| HV306_RS04455 (HV306_04455) | - | 905461..905862 (-) | 402 | WP_048797722.1 | hypothetical protein | - |
| HV306_RS04460 (HV306_04460) | - | 906059..906507 (-) | 449 | Protein_886 | DDE-type integrase/transposase/recombinase | - |
| HV306_RS04465 (HV306_04465) | - | 906804..907349 (+) | 546 | WP_039187748.1 | 3'-5' exonuclease | - |
| HV306_RS04470 (HV306_04470) | - | 907361..907849 (-) | 489 | WP_077267666.1 | Mov34/MPN/PAD-1 family protein | - |
| HV306_RS04475 (HV306_04475) | - | 907849..909627 (-) | 1779 | WP_077267667.1 | HesA/MoeB/ThiF family protein | - |
| HV306_RS04480 (HV306_04480) | - | 909620..910243 (-) | 624 | Protein_890 | nucleotidyltransferase | - |
| HV306_RS04485 (HV306_04485) | - | 910278..911246 (+) | 969 | WP_000654811.1 | IS5 family transposase | - |
| HV306_RS04490 (HV306_04490) | - | 911291..912706 (+) | 1416 | Protein_892 | 3'-5' exonuclease | - |
| HV306_RS04495 (HV306_04495) | - | 912773..914392 (+) | 1620 | WP_016807924.1 | TraI domain-containing protein | - |
| HV306_RS04500 (HV306_04500) | - | 914453..915484 (+) | 1032 | WP_016807923.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 163 a.a. Molecular weight: 17688.56 Da Isoelectric Point: 5.7627
>NTDB_id=457538 HV306_RS04240 WP_181247627.1 864249..864740(+) (ssb) [Klebsiella grimontii strain RHBSTW-00866]
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYMRKGSQVYI
EGQLRTRKWTDQSGQEKYITEVVVNIGGTMQMLGGRQSGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDD
IPF
MSSRGVNKVILVGNLGQDPEVRYIPNGSAVATLSLATSESWRDKQSGEQKEVTEWHRVVIFGKLAEIAGEYMRKGSQVYI
EGQLRTRKWTDQSGQEKYITEVVVNIGGTMQMLGGRQSGSGQNTSSRNDWGQPQQPSGPTHSGQASGSSAGAPPMDFDDD
IPF
Nucleotide
Download Length: 492 bp
>NTDB_id=457538 HV306_RS04240 WP_181247627.1 864249..864740(+) (ssb) [Klebsiella grimontii strain RHBSTW-00866]
ATGTCCTCACGCGGCGTTAACAAGGTGATTCTTGTCGGTAATCTCGGCCAGGATCCTGAAGTGCGTTATATTCCCAATGG
CAGTGCAGTTGCCACCCTTTCTCTGGCCACGTCTGAGAGCTGGCGTGATAAGCAGTCCGGTGAACAGAAAGAAGTGACCG
AATGGCACCGAGTGGTTATTTTCGGCAAGCTGGCAGAAATTGCGGGTGAATATATGCGCAAAGGCTCCCAGGTTTACATC
GAGGGCCAGCTGCGCACACGCAAATGGACCGATCAGTCCGGCCAGGAGAAATACATCACAGAGGTGGTGGTAAACATTGG
TGGCACTATGCAGATGCTTGGCGGTCGCCAGTCCGGCAGCGGTCAGAATACGTCTTCCCGGAATGACTGGGGCCAGCCTC
AGCAACCTTCCGGACCGACTCACAGTGGCCAGGCTTCCGGCAGCAGTGCCGGTGCGCCACCGATGGACTTCGATGACGAT
ATACCGTTCTGA
ATGTCCTCACGCGGCGTTAACAAGGTGATTCTTGTCGGTAATCTCGGCCAGGATCCTGAAGTGCGTTATATTCCCAATGG
CAGTGCAGTTGCCACCCTTTCTCTGGCCACGTCTGAGAGCTGGCGTGATAAGCAGTCCGGTGAACAGAAAGAAGTGACCG
AATGGCACCGAGTGGTTATTTTCGGCAAGCTGGCAGAAATTGCGGGTGAATATATGCGCAAAGGCTCCCAGGTTTACATC
GAGGGCCAGCTGCGCACACGCAAATGGACCGATCAGTCCGGCCAGGAGAAATACATCACAGAGGTGGTGGTAAACATTGG
TGGCACTATGCAGATGCTTGGCGGTCGCCAGTCCGGCAGCGGTCAGAATACGTCTTCCCGGAATGACTGGGGCCAGCCTC
AGCAACCTTCCGGACCGACTCACAGTGGCCAGGCTTCCGGCAGCAGTGCCGGTGCGCCACCGATGGACTTCGATGACGAT
ATACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
62.147 |
100 |
0.675 |
| ssb | Glaesserella parasuis strain SC1401 |
48.619 |
100 |
0.54 |
| ssb | Neisseria meningitidis MC58 |
44.068 |
100 |
0.479 |
| ssb | Neisseria gonorrhoeae MS11 |
43.75 |
100 |
0.472 |