Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HUZ91_RS08385 Genome accession   NZ_CP055070
Coordinates   1753111..1753617 (-) Length   168 a.a.
NCBI ID   WP_000168274.1    Uniprot ID   A0A9X0Q0X8
Organism   Shigella flexneri strain SWHIN_97     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1748866..1788375 1753111..1753617 within 0


Gene organization within MGE regions


Location: 1748866..1788375
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUZ91_RS08345 (HUZ91_08300) - 1749743..1749934 (-) 192 WP_000132739.1 AlpA family phage regulatory protein -
  HUZ91_RS08350 (HUZ91_08305) - 1750012..1750356 (-) 345 WP_181464054.1 hypothetical protein -
  HUZ91_RS08355 (HUZ91_08310) - 1750457..1750636 (-) 180 WP_032169734.1 Eag protein -
  HUZ91_RS08360 (HUZ91_08315) - 1750733..1751392 (-) 660 WP_152061863.1 DUF551 domain-containing protein -
  HUZ91_RS08365 (HUZ91_08320) - 1751389..1751994 (-) 606 WP_239606144.1 ead/Ea22-like family protein -
  HUZ91_RS08370 (HUZ91_08325) - 1751982..1752626 (-) 645 WP_239606145.1 hypothetical protein -
  HUZ91_RS08375 (HUZ91_08330) - 1752623..1752790 (-) 168 WP_016242508.1 DUF2737 family protein -
  HUZ91_RS08380 (HUZ91_08335) - 1752801..1753097 (-) 297 WP_001111336.1 phage anti-RecBCD protein -
  HUZ91_RS08385 (HUZ91_08340) ssb 1753111..1753617 (-) 507 WP_000168274.1 single-stranded DNA-binding protein Machinery gene
  HUZ91_RS08390 (HUZ91_08345) - 1753618..1754325 (-) 708 WP_053880671.1 Rad52/Rad22 family DNA repair protein -
  HUZ91_RS08395 (HUZ91_08350) - 1754334..1754504 (-) 171 WP_000050554.1 hypothetical protein -
  HUZ91_RS08400 (HUZ91_08355) - 1754580..1754750 (-) 171 WP_001183771.1 hypothetical protein -
  HUZ91_RS08405 (HUZ91_08360) - 1754990..1755178 (-) 189 WP_021549877.1 hypothetical protein -
  HUZ91_RS08410 (HUZ91_08365) - 1755187..1755513 (-) 327 WP_000378298.1 antitermination protein N -
  HUZ91_RS24770 - 1755555..1755683 (-) 129 WP_000682198.1 hypothetical protein -
  HUZ91_RS08415 (HUZ91_08370) - 1756058..1756369 (-) 312 WP_001418420.1 hypothetical protein -
  HUZ91_RS08420 (HUZ91_08375) - 1756459..1757091 (-) 633 WP_000028393.1 LexA family transcriptional regulator -
  HUZ91_RS08425 (HUZ91_08380) - 1757195..1757410 (+) 216 WP_001194218.1 helix-turn-helix transcriptional regulator -
  HUZ91_RS08430 (HUZ91_08385) - 1757530..1757808 (+) 279 WP_001177649.1 lambda phage CII family protein -
  HUZ91_RS08435 (HUZ91_08390) - 1757843..1758004 (+) 162 WP_000166961.1 hypothetical protein -
  HUZ91_RS08440 (HUZ91_08395) - 1757991..1758881 (+) 891 WP_024190675.1 hypothetical protein -
  HUZ91_RS08445 (HUZ91_08400) - 1758871..1760307 (+) 1437 WP_047659744.1 DnaB-like helicase C-terminal domain-containing protein -
  HUZ91_RS08450 (HUZ91_08405) - 1760383..1760589 (+) 207 WP_001535915.1 hypothetical protein -
  HUZ91_RS08455 (HUZ91_08410) - 1760607..1760924 (+) 318 WP_239606148.1 hypothetical protein -
  HUZ91_RS08460 (HUZ91_08415) - 1760929..1761183 (+) 255 WP_023145903.1 hypothetical protein -
  HUZ91_RS08465 (HUZ91_08420) - 1761164..1761604 (+) 441 WP_016238076.1 recombination protein NinB -
  HUZ91_RS08470 (HUZ91_08425) - 1761601..1762128 (+) 528 WP_000153288.1 phage N-6-adenine-methyltransferase -
  HUZ91_RS08475 (HUZ91_08430) - 1762125..1762301 (+) 177 WP_112918099.1 NinE family protein -
  HUZ91_RS08480 (HUZ91_08435) - 1762304..1762687 (+) 384 WP_096313554.1 phage protein NinX family protein -
  HUZ91_RS08485 (HUZ91_08440) - 1762680..1762856 (+) 177 WP_044066505.1 protein NinF -
  HUZ91_RS08490 (HUZ91_08445) - 1762849..1763118 (+) 270 WP_016242496.1 hypothetical protein -
  HUZ91_RS08495 (HUZ91_08450) - 1763118..1763408 (+) 291 WP_000002228.1 DUF1364 domain-containing protein -
  HUZ91_RS08500 (HUZ91_08455) - 1763405..1763767 (+) 363 WP_001008180.1 RusA family crossover junction endodeoxyribonuclease -
  HUZ91_RS08505 (HUZ91_08460) - 1763764..1763952 (+) 189 WP_000994516.1 protein ninH -
  HUZ91_RS08510 (HUZ91_08465) - 1763949..1764572 (+) 624 WP_001235461.1 antitermination protein -
  HUZ91_RS08515 (HUZ91_08470) - 1765005..1765328 (+) 324 WP_000783734.1 phage holin, lambda family -
  HUZ91_RS08520 (HUZ91_08475) - 1765312..1765788 (+) 477 WP_000229396.1 glycoside hydrolase family protein -
  HUZ91_RS08525 (HUZ91_08480) - 1765785..1766252 (+) 468 WP_021537017.1 lysis protein -
  HUZ91_RS08530 (HUZ91_08485) - 1766240..1766392 (+) 153 WP_001139682.1 hypothetical protein -
  HUZ91_RS08535 (HUZ91_08490) - 1766472..1766759 (+) 288 WP_000343115.1 hypothetical protein -
  HUZ91_RS08540 (HUZ91_08495) - 1767054..1767296 (+) 243 WP_000807788.1 DUF2560 family protein -
  HUZ91_RS08545 (HUZ91_08500) - 1767372..1767608 (-) 237 WP_001673925.1 hypothetical protein -
  HUZ91_RS08550 (HUZ91_08505) - 1767656..1767838 (-) 183 WP_001601998.1 DUF2158 domain-containing protein -
  HUZ91_RS08555 (HUZ91_08510) - 1767865..1768392 (+) 528 WP_089602606.1 terminase small subunit -
  HUZ91_RS08560 (HUZ91_08515) - 1768389..1769804 (+) 1416 WP_089602607.1 PBSX family phage terminase large subunit -
  HUZ91_RS08565 (HUZ91_08520) - 1769806..1772004 (+) 2199 WP_239606150.1 portal protein -
  HUZ91_RS08570 (HUZ91_08525) - 1772095..1772988 (+) 894 WP_085455941.1 scaffolding protein -
  HUZ91_RS08575 (HUZ91_08530) - 1773007..1774260 (+) 1254 WP_001462595.1 P22 phage major capsid protein family protein -
  HUZ91_RS08580 (HUZ91_08535) - 1774302..1774490 (+) 189 WP_001462613.1 hypothetical protein -
  HUZ91_RS08585 (HUZ91_08540) - 1774471..1774932 (+) 462 WP_001140510.1 packaged DNA stabilization gp4 family protein -
  HUZ91_RS08590 (HUZ91_08545) - 1774942..1776360 (+) 1419 WP_001576812.1 packaged DNA stabilization protein gp10 -
  HUZ91_RS08595 (HUZ91_08550) - 1776360..1777313 (+) 954 WP_105075739.1 tail needle knob protein -
  HUZ91_RS08600 (HUZ91_08555) - 1777313..1777768 (+) 456 WP_000614031.1 DUF2824 family protein -
  HUZ91_RS08605 (HUZ91_08560) - 1777771..1778463 (+) 693 WP_239606152.1 DNA transfer protein -
  HUZ91_RS08610 (HUZ91_08565) - 1778473..1779804 (+) 1332 WP_239606154.1 phage DNA ejection protein -
  HUZ91_RS08615 (HUZ91_08570) - 1779805..1782198 (+) 2394 WP_239606156.1 lytic transglycosylase domain-containing protein -
  HUZ91_RS08620 (HUZ91_08575) - 1782288..1782547 (-) 260 Protein_1692 Arc family DNA-binding protein -
  HUZ91_RS08625 (HUZ91_08580) - 1782681..1784963 (+) 2283 WP_239606158.1 phage tailspike protein -
  HUZ91_RS08630 (HUZ91_08585) - 1784999..1786264 (-) 1266 WP_239606166.1 hypothetical protein -
  HUZ91_RS08635 (HUZ91_08590) - 1786402..1787712 (+) 1311 WP_239606169.1 right-handed parallel beta-helix repeat-containing protein -
  HUZ91_RS08640 (HUZ91_08595) - 1787819..1788058 (+) 240 WP_000555017.1 hypothetical protein -
  HUZ91_RS08645 (HUZ91_08600) - 1788058..1788375 (+) 318 WP_000506723.1 hypothetical protein -

Sequence


Protein


Download         Length: 168 a.a.        Molecular weight: 18731.03 Da        Isoelectric Point: 8.4877

>NTDB_id=456101 HUZ91_RS08385 WP_000168274.1 1753111..1753617(-) (ssb) [Shigella flexneri strain SWHIN_97]
MASRGVNKVIILGRVGQDPEVRYSPSGTAFANLTIATSEQWRDKNTGEQKELTEWHRVAVSGKLAEVVGQYVKKGDQIYF
EGMLRTRKWKDQSGQDRYTTEVHVGINGVMQMLGGIGDSKQQAASRQSQKPQQQSSPAQHNEPPMDFDDDIPFAPVTLPF
PRHAIHAI

Nucleotide


Download         Length: 507 bp        

>NTDB_id=456101 HUZ91_RS08385 WP_000168274.1 1753111..1753617(-) (ssb) [Shigella flexneri strain SWHIN_97]
ATGGCAAGCAGAGGCGTAAATAAGGTGATTATCCTTGGTCGGGTAGGACAAGACCCGGAAGTTCGATACTCACCATCAGG
AACAGCGTTCGCTAACCTGACAATAGCCACGTCAGAACAATGGCGAGATAAAAATACTGGCGAGCAAAAGGAATTGACTG
AATGGCATCGTGTTGCTGTATCCGGGAAACTGGCTGAGGTCGTGGGGCAGTATGTGAAAAAAGGTGATCAGATTTATTTC
GAGGGAATGCTGAGAACCAGAAAGTGGAAAGACCAGTCAGGGCAAGACCGTTACACAACCGAGGTTCATGTCGGAATTAA
TGGCGTGATGCAGATGCTTGGCGGCATTGGCGACAGCAAACAACAAGCAGCCAGCAGGCAATCACAGAAGCCACAGCAGC
AATCATCACCAGCACAACACAACGAACCTCCGATGGATTTTGACGACGATATACCCTTTGCACCAGTAACTCTCCCCTTC
CCTCGTCACGCTATTCACGCAATTTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

62.147

100

0.655

  ssb Glaesserella parasuis strain SC1401

45.856

100

0.494

  ssb Neisseria meningitidis MC58

38.636

100

0.405

  ssb Neisseria gonorrhoeae MS11

38.636

100

0.405