Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   HUZ60_RS06645 Genome accession   NZ_CP054977
Coordinates   1369311..1369784 (-) Length   157 a.a.
NCBI ID   WP_000168265.1    Uniprot ID   -
Organism   Shigella flexneri strain STIN_92     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1364261..1419789 1369311..1369784 within 0


Gene organization within MGE regions


Location: 1364261..1419789
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HUZ60_RS06595 (HUZ60_06545) dsdC 1364261..1365196 (+) 936 WP_001300996.1 DNA-binding transcriptional regulator DsdC -
  HUZ60_RS06600 (HUZ60_06550) torI 1365380..1365580 (-) 201 WP_001163428.1 response regulator inhibitor TorI -
  HUZ60_RS06605 (HUZ60_06555) - 1365704..1366048 (-) 345 WP_001281193.1 hypothetical protein -
  HUZ60_RS06610 (HUZ60_06560) - 1366149..1366328 (-) 180 WP_001277767.1 Eag protein -
  HUZ60_RS06615 (HUZ60_06565) - 1366425..1367054 (-) 630 WP_064770252.1 dATP/dGTP pyrophosphohydrolase domain-containing protein -
  HUZ60_RS06620 (HUZ60_06570) - 1367056..1367700 (-) 645 WP_059329558.1 ead/Ea22-like family protein -
  HUZ60_RS06625 (HUZ60_06575) - 1367697..1368203 (-) 507 WP_323135015.1 ead/Ea22-like family protein -
  HUZ60_RS06630 - 1368158..1368340 (-) 183 WP_069723431.1 ead/Ea22-like family protein -
  HUZ60_RS06635 (HUZ60_06580) - 1368337..1368504 (-) 168 WP_001214460.1 DUF2737 family protein -
  HUZ60_RS06640 (HUZ60_06585) - 1368515..1368808 (-) 294 WP_001111278.1 phage anti-RecBCD protein -
  HUZ60_RS06645 (HUZ60_06590) ssb 1369311..1369784 (-) 474 WP_000168265.1 single-stranded DNA-binding protein Machinery gene
  HUZ60_RS06650 (HUZ60_06595) - 1369785..1370492 (-) 708 WP_000365280.1 Rad52/Rad22 family DNA repair protein -
  HUZ60_RS06655 (HUZ60_06600) - 1370501..1370671 (-) 171 WP_016248933.1 hypothetical protein -
  HUZ60_RS06660 (HUZ60_06605) - 1370747..1370917 (-) 171 WP_001183771.1 hypothetical protein -
  HUZ60_RS06665 (HUZ60_06610) - 1371156..1371605 (-) 450 WP_072667138.1 hypothetical protein -
  HUZ60_RS06670 (HUZ60_06615) - 1371614..1371919 (-) 306 WP_105310534.1 hypothetical protein -
  HUZ60_RS06675 (HUZ60_06620) - 1372374..1372742 (-) 369 WP_106509572.1 hypothetical protein -
  HUZ60_RS06680 (HUZ60_06625) - 1372762..1373478 (-) 717 WP_000428318.1 S24 family peptidase -
  HUZ60_RS06685 (HUZ60_06630) - 1373585..1373779 (+) 195 WP_000620665.1 Cro/CI family transcriptional regulator -
  HUZ60_RS06690 (HUZ60_06635) - 1373888..1374166 (+) 279 WP_001177653.1 lambda phage CII family protein -
  HUZ60_RS06695 (HUZ60_06640) - 1374201..1374362 (+) 162 WP_000166961.1 hypothetical protein -
  HUZ60_RS06700 (HUZ60_06645) - 1374349..1375170 (+) 822 WP_105310535.1 replication protein -
  HUZ60_RS06705 (HUZ60_06650) - 1375167..1376543 (+) 1377 WP_239636712.1 replicative DNA helicase -
  HUZ60_RS06710 (HUZ60_06655) - 1376617..1377057 (+) 441 WP_000736913.1 recombination protein NinB -
  HUZ60_RS06715 (HUZ60_06660) - 1377054..1377236 (+) 183 WP_016063117.1 NinE family protein -
  HUZ60_RS06720 (HUZ60_06665) - 1377233..1377403 (+) 171 WP_021520333.1 protein NinF -
  HUZ60_RS06725 (HUZ60_06670) - 1377396..1377905 (+) 510 WP_001286130.1 NUMOD4 motif-containing HNH endonuclease -
  HUZ60_RS06730 - 1377898..1378173 (+) 276 WP_105310537.1 hypothetical protein -
  HUZ60_RS06735 (HUZ60_06675) - 1378170..1378532 (+) 363 WP_001008199.1 RusA family crossover junction endodeoxyribonuclease -
  HUZ60_RS06740 (HUZ60_06680) - 1378529..1378717 (+) 189 WP_000994516.1 protein ninH -
  HUZ60_RS06745 (HUZ60_06685) - 1378714..1379337 (+) 624 WP_079917327.1 antitermination protein -
  HUZ60_RS06750 (HUZ60_06690) - 1379771..1380094 (+) 324 WP_015980128.1 phage holin, lambda family -
  HUZ60_RS06755 (HUZ60_06695) - 1380078..1380554 (+) 477 WP_021521977.1 glycoside hydrolase family protein -
  HUZ60_RS06760 (HUZ60_06700) - 1380551..1381018 (+) 468 WP_057077877.1 lysis protein -
  HUZ60_RS06765 (HUZ60_06705) - 1381076..1381648 (+) 573 WP_171785568.1 terminase small subunit -
  HUZ60_RS06770 (HUZ60_06710) - 1381651..1383273 (+) 1623 WP_023565726.1 hypothetical protein -
  HUZ60_RS06775 (HUZ60_06715) - 1383273..1384739 (+) 1467 WP_106509573.1 DUF1073 domain-containing protein -
  HUZ60_RS06780 (HUZ60_06720) - 1384756..1385364 (+) 609 WP_000339323.1 phage minor head protein -
  HUZ60_RS06785 (HUZ60_06725) - 1385379..1386599 (+) 1221 WP_086353605.1 DUF2213 domain-containing protein -
  HUZ60_RS06790 (HUZ60_06730) - 1386603..1387109 (+) 507 WP_057077880.1 hypothetical protein -
  HUZ60_RS06795 (HUZ60_06735) - 1387121..1388062 (+) 942 WP_219384105.1 major capsid family protein -
  HUZ60_RS06800 (HUZ60_06740) - 1388104..1388493 (+) 390 WP_032238373.1 hypothetical protein -
  HUZ60_RS06805 (HUZ60_06745) - 1388459..1388866 (+) 408 WP_032238372.1 DUF4054 domain-containing protein -
  HUZ60_RS06810 (HUZ60_06750) - 1388863..1389417 (+) 555 WP_219384104.1 hypothetical protein -
  HUZ60_RS06815 (HUZ60_06755) - 1389404..1389793 (+) 390 WP_001142482.1 hypothetical protein -
  HUZ60_RS06820 (HUZ60_06760) - 1389768..1390331 (+) 564 WP_033544654.1 hypothetical protein -
  HUZ60_RS06825 (HUZ60_06765) - 1390335..1391480 (+) 1146 WP_096988381.1 DUF3383 family protein -
  HUZ60_RS06830 (HUZ60_06770) - 1391491..1391931 (+) 441 WP_000109249.1 DUF3277 family protein -
  HUZ60_RS06835 (HUZ60_06775) - 1391935..1392387 (+) 453 WP_105310541.1 phage tail assembly chaperone -
  HUZ60_RS06840 - 1392399..1392575 (+) 177 WP_023141050.1 hypothetical protein -
  HUZ60_RS06845 (HUZ60_06780) - 1392565..1394553 (+) 1989 WP_105310542.1 lytic transglycosylase -
  HUZ60_RS06850 (HUZ60_06785) - 1394553..1395140 (+) 588 WP_057077883.1 phage baseplate protein -
  HUZ60_RS06855 (HUZ60_06790) - 1395140..1395442 (+) 303 WP_021568411.1 hypothetical protein -
  HUZ60_RS06860 (HUZ60_06795) - 1395445..1396509 (+) 1065 WP_057077884.1 hypothetical protein -
  HUZ60_RS06865 (HUZ60_06800) - 1396509..1396841 (+) 333 WP_040063285.1 hypothetical protein -
  HUZ60_RS06870 (HUZ60_06805) - 1396895..1397134 (+) 240 WP_000466689.1 DUF4282 domain-containing protein -
  HUZ60_RS06875 (HUZ60_06810) - 1397194..1397949 (+) 756 WP_057077885.1 Gp138 family membrane-puncturing spike protein -
  HUZ60_RS06880 (HUZ60_06815) - 1397949..1398302 (+) 354 WP_001270634.1 hypothetical protein -
  HUZ60_RS06885 (HUZ60_06820) - 1398302..1399498 (+) 1197 WP_057077886.1 baseplate J/gp47 family protein -
  HUZ60_RS06890 (HUZ60_06825) - 1399495..1400268 (+) 774 WP_106504451.1 DUF2612 domain-containing protein -
  HUZ60_RS06895 (HUZ60_06835) - 1400405..1400602 (+) 198 WP_016244718.1 hypothetical protein -
  HUZ60_RS06905 - 1400661..1402346 (+) 1686 WP_219356475.1 SGNH/GDSL hydrolase family protein -
  HUZ60_RS06910 (HUZ60_06845) - 1402352..1403155 (+) 804 WP_106504450.1 hypothetical protein -
  HUZ60_RS06915 (HUZ60_06850) - 1403282..1403521 (+) 240 WP_057077890.1 hypothetical protein -
  HUZ60_RS06920 (HUZ60_06855) - 1403521..1403838 (+) 318 WP_057077891.1 hypothetical protein -
  HUZ60_RS06925 (HUZ60_06860) - 1404061..1404285 (-) 225 Protein_1353 tyrosine-type recombinase/integrase -
  HUZ60_RS06930 (HUZ60_06865) - 1404277..1404765 (+) 489 Protein_1354 DUF2612 domain-containing protein -
  HUZ60_RS06935 - 1404765..1405664 (+) 900 WP_239636755.1 phage tail protein -
  HUZ60_RS06940 (HUZ60_06875) - 1405667..1406083 (+) 417 WP_086353615.1 tail fiber assembly protein -
  HUZ60_RS06945 (HUZ60_06880) intS 1406171..1407328 (-) 1158 WP_000958671.1 prophage integrase IntS -
  HUZ60_RS06955 (HUZ60_06890) - 1407640..1408572 (-) 933 WP_024238820.1 formate/nitrite transporter family protein -
  HUZ60_RS06960 (HUZ60_06895) mlaA 1408866..1409621 (+) 756 WP_000776768.1 phospholipid-binding lipoprotein MlaA -
  HUZ60_RS06965 (HUZ60_06900) yfdF 1409803..1410861 (-) 1059 WP_000937786.1 protein YfdF -
  HUZ60_RS06970 (HUZ60_06905) fadL 1411227..1412567 (-) 1341 WP_001400735.1 long-chain fatty acid transporter FadL -
  HUZ60_RS06975 (HUZ60_06910) - 1412939..1413223 (+) 285 WP_001296261.1 YfcZ/YiiS family protein -
  HUZ60_RS06980 (HUZ60_06915) fadI 1413404..1414714 (+) 1311 WP_001530662.1 acetyl-CoA C-acyltransferase FadI -
  HUZ60_RS06985 (HUZ60_06920) fadJ 1414714..1416858 (+) 2145 WP_001618735.1 fatty acid oxidation complex subunit alpha FadJ -
  HUZ60_RS06990 (HUZ60_06925) sixA 1417061..1417546 (+) 486 WP_001195819.1 phosphohistidine phosphatase SixA -
  HUZ60_RS06995 (HUZ60_06930) - 1418227..1418790 (+) 564 WP_000033316.1 fimbrial protein -
  HUZ60_RS07000 (HUZ60_06935) - 1418872..1419081 (+) 210 WP_063097536.1 FimD/PapC N-terminal domain-containing protein -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17618.48 Da        Isoelectric Point: 7.3192

>NTDB_id=455558 HUZ60_RS06645 WP_000168265.1 1369311..1369784(-) (ssb) [Shigella flexneri strain STIN_92]
MASRGVNKVIIIGRLGHDPEIRYSPSGTAFANLTVATSEQWRDKQTGEQKEQTEWHRVVMSGKLAEIASEYLRKGSEVYL
EGKLRTRKWQDQSGQDRFTTEVIVGVGGTMQMLGGKQGGNEQSSPQRNNGQQQRQQPQQQGNHSEPPMNFDDSDIPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=455558 HUZ60_RS06645 WP_000168265.1 1369311..1369784(-) (ssb) [Shigella flexneri strain STIN_92]
ATGGCAAGCAGAGGCGTAAATAAGGTGATCATTATTGGTCGCCTTGGGCATGATCCAGAAATCAGATATTCACCATCAGG
AACGGCATTTGCAAACCTTACAGTTGCTACGTCAGAACAATGGCGTGATAAGCAAACTGGAGAGCAAAAGGAGCAGACGG
AGTGGCACCGTGTGGTAATGAGCGGGAAACTGGCAGAAATTGCCAGCGAGTATCTGCGGAAAGGCTCAGAGGTTTATCTT
GAAGGCAAATTGCGGACAAGAAAATGGCAGGATCAAAGTGGACAGGATCGGTTCACTACCGAAGTCATCGTGGGCGTTGG
TGGAACCATGCAAATGCTTGGTGGCAAGCAAGGAGGCAATGAACAGTCTTCACCTCAGCGAAATAATGGTCAGCAACAAA
GACAGCAACCTCAGCAGCAGGGTAATCACAGCGAACCACCTATGAACTTCGACGATTCGGATATTCCGTTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Vibrio cholerae strain A1552

59.89

100

0.694

  ssb Glaesserella parasuis strain SC1401

52.198

100

0.605

  ssb Neisseria meningitidis MC58

41.808

100

0.471

  ssb Neisseria gonorrhoeae MS11

40.909

100

0.459