Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HTY61_RS09950 | Genome accession | NZ_CP054836 |
| Coordinates | 2033477..2033986 (+) | Length | 169 a.a. |
| NCBI ID | WP_175276642.1 | Uniprot ID | - |
| Organism | Oricola thermophila strain MEBiC13590 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1992242..2040276 | 2033477..2033986 | within | 0 |
Gene organization within MGE regions
Location: 1992242..2040276
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTY61_RS09685 (HTY61_09685) | - | 1992242..1992511 (+) | 270 | WP_175276592.1 | hypothetical protein | - |
| HTY61_RS09690 (HTY61_09690) | - | 1992486..1993085 (-) | 600 | WP_175276593.1 | deoxynucleotide monophosphate kinase | - |
| HTY61_RS09695 (HTY61_09695) | - | 1993064..1994434 (-) | 1371 | WP_175276594.1 | hypothetical protein | - |
| HTY61_RS09700 (HTY61_09700) | - | 1994449..1994919 (-) | 471 | WP_175276595.1 | hypothetical protein | - |
| HTY61_RS09705 (HTY61_09705) | - | 1995017..1995316 (-) | 300 | WP_175276596.1 | hypothetical protein | - |
| HTY61_RS09710 (HTY61_09710) | - | 1995276..1995716 (-) | 441 | WP_175276597.1 | hypothetical protein | - |
| HTY61_RS09715 (HTY61_09715) | - | 1995713..1996228 (-) | 516 | WP_175276598.1 | lysozyme | - |
| HTY61_RS09720 (HTY61_09720) | - | 1996231..1996440 (-) | 210 | WP_175276599.1 | hypothetical protein | - |
| HTY61_RS09725 (HTY61_09725) | - | 1996506..1997027 (-) | 522 | WP_175276600.1 | hypothetical protein | - |
| HTY61_RS09730 (HTY61_09730) | - | 1997030..1999369 (-) | 2340 | WP_175276601.1 | hypothetical protein | - |
| HTY61_RS09735 (HTY61_09735) | - | 1999379..2000944 (-) | 1566 | WP_175276602.1 | hypothetical protein | - |
| HTY61_RS09740 (HTY61_09740) | - | 2000944..2003472 (-) | 2529 | WP_175276603.1 | phage tail protein | - |
| HTY61_RS09745 (HTY61_09745) | - | 2003466..2003888 (-) | 423 | WP_175276604.1 | hypothetical protein | - |
| HTY61_RS09750 (HTY61_09750) | - | 2003885..2004463 (-) | 579 | WP_175276605.1 | DUF2163 domain-containing protein | - |
| HTY61_RS09755 (HTY61_09755) | - | 2004463..2005101 (-) | 639 | WP_175276606.1 | hypothetical protein | - |
| HTY61_RS09760 (HTY61_09760) | - | 2005109..2007022 (-) | 1914 | WP_175276607.1 | hypothetical protein | - |
| HTY61_RS09765 (HTY61_09765) | - | 2007019..2007198 (-) | 180 | WP_210268604.1 | phage tail assembly chaperone | - |
| HTY61_RS09770 (HTY61_09770) | - | 2007216..2007635 (-) | 420 | WP_175276609.1 | hypothetical protein | - |
| HTY61_RS09775 (HTY61_09775) | - | 2007638..2008117 (-) | 480 | WP_175276610.1 | hypothetical protein | - |
| HTY61_RS09780 (HTY61_09780) | - | 2008130..2008552 (-) | 423 | WP_175276611.1 | hypothetical protein | - |
| HTY61_RS09785 (HTY61_09785) | - | 2008552..2008881 (-) | 330 | WP_175276612.1 | hypothetical protein | - |
| HTY61_RS09790 (HTY61_09790) | - | 2008891..2009250 (-) | 360 | WP_175276613.1 | hypothetical protein | - |
| HTY61_RS09795 (HTY61_09795) | - | 2009345..2010373 (-) | 1029 | WP_175276614.1 | major capsid protein | - |
| HTY61_RS09800 (HTY61_09800) | - | 2010384..2010743 (-) | 360 | WP_175276615.1 | head decoration protein | - |
| HTY61_RS09805 (HTY61_09805) | - | 2010762..2011304 (-) | 543 | WP_175276616.1 | hypothetical protein | - |
| HTY61_RS09810 (HTY61_09810) | - | 2011324..2012208 (-) | 885 | WP_175276617.1 | S49 family peptidase | - |
| HTY61_RS09815 (HTY61_09815) | - | 2012205..2013911 (-) | 1707 | WP_175276618.1 | phage portal protein | - |
| HTY61_RS09820 (HTY61_09820) | gpW | 2013908..2014159 (-) | 252 | WP_197945298.1 | gpW family head-tail joining protein | - |
| HTY61_RS09825 (HTY61_09825) | - | 2014163..2016187 (-) | 2025 | WP_175276619.1 | terminase gpA endonuclease subunit | - |
| HTY61_RS09830 (HTY61_09830) | - | 2016184..2016849 (-) | 666 | WP_210268605.1 | hypothetical protein | - |
| HTY61_RS09835 (HTY61_09835) | - | 2017109..2017864 (-) | 756 | WP_175276621.1 | hypothetical protein | - |
| HTY61_RS09840 (HTY61_09840) | - | 2017949..2018704 (-) | 756 | WP_175276622.1 | hypothetical protein | - |
| HTY61_RS09845 (HTY61_09845) | - | 2019162..2019659 (+) | 498 | WP_175276623.1 | hypothetical protein | - |
| HTY61_RS09850 (HTY61_09850) | - | 2019665..2021452 (-) | 1788 | WP_175276624.1 | DNA primase family protein | - |
| HTY61_RS09855 (HTY61_09855) | - | 2021449..2022690 (-) | 1242 | WP_246272772.1 | P4 alpha zinc-binding domain-containing protein | - |
| HTY61_RS09860 (HTY61_09860) | - | 2022687..2023049 (-) | 363 | WP_175276625.1 | hypothetical protein | - |
| HTY61_RS09865 (HTY61_09865) | - | 2023046..2023867 (-) | 822 | WP_197945299.1 | HNH endonuclease signature motif containing protein | - |
| HTY61_RS09870 (HTY61_09870) | - | 2023864..2024103 (-) | 240 | WP_175276626.1 | hypothetical protein | - |
| HTY61_RS09875 (HTY61_09875) | - | 2024100..2024300 (-) | 201 | WP_175276627.1 | hypothetical protein | - |
| HTY61_RS09880 (HTY61_09880) | - | 2024278..2024616 (-) | 339 | WP_175276628.1 | hypothetical protein | - |
| HTY61_RS09885 (HTY61_09885) | - | 2024613..2025437 (-) | 825 | WP_175276629.1 | hypothetical protein | - |
| HTY61_RS09890 (HTY61_09890) | - | 2025434..2025835 (-) | 402 | WP_175276630.1 | hypothetical protein | - |
| HTY61_RS09895 (HTY61_09895) | - | 2025832..2028525 (-) | 2694 | WP_175276631.1 | DNA methyltransferase | - |
| HTY61_RS09900 (HTY61_09900) | - | 2028522..2029394 (-) | 873 | WP_175276632.1 | ParB N-terminal domain-containing protein | - |
| HTY61_RS09905 (HTY61_09905) | - | 2029394..2029888 (-) | 495 | WP_175276633.1 | hypothetical protein | - |
| HTY61_RS09915 (HTY61_09915) | - | 2030127..2030438 (-) | 312 | WP_175276635.1 | hypothetical protein | - |
| HTY61_RS09920 (HTY61_09920) | - | 2030533..2031234 (+) | 702 | WP_175276636.1 | LexA family transcriptional regulator | - |
| HTY61_RS09925 (HTY61_09925) | - | 2031238..2031861 (-) | 624 | WP_175276637.1 | type VI secretion system-associated protein TagO | - |
| HTY61_RS09930 (HTY61_09930) | - | 2032008..2032313 (+) | 306 | WP_175276638.1 | hypothetical protein | - |
| HTY61_RS09935 (HTY61_09935) | - | 2032310..2032513 (+) | 204 | WP_175276639.1 | hypothetical protein | - |
| HTY61_RS09940 (HTY61_09940) | - | 2032516..2033163 (+) | 648 | WP_175276640.1 | hypothetical protein | - |
| HTY61_RS09945 (HTY61_09945) | - | 2033160..2033477 (+) | 318 | WP_175276641.1 | hypothetical protein | - |
| HTY61_RS09950 (HTY61_09950) | ssb | 2033477..2033986 (+) | 510 | WP_175276642.1 | single-stranded DNA-binding protein | Machinery gene |
| HTY61_RS09955 (HTY61_09955) | - | 2033996..2034244 (+) | 249 | WP_175276643.1 | hypothetical protein | - |
| HTY61_RS09960 (HTY61_09960) | - | 2034241..2034663 (+) | 423 | WP_175276644.1 | hypothetical protein | - |
| HTY61_RS09965 (HTY61_09965) | - | 2034660..2034926 (+) | 267 | WP_175276645.1 | DUF2312 domain-containing protein | - |
| HTY61_RS09970 (HTY61_09970) | - | 2034923..2035129 (+) | 207 | WP_175276646.1 | hypothetical protein | - |
| HTY61_RS09975 (HTY61_09975) | dnaN | 2035122..2036270 (+) | 1149 | WP_175276647.1 | DNA polymerase III subunit beta | - |
| HTY61_RS09980 (HTY61_09980) | - | 2036458..2037585 (+) | 1128 | WP_175276648.1 | site-specific integrase | - |
| HTY61_RS09985 (HTY61_09985) | - | 2037983..2038171 (+) | 189 | WP_175276649.1 | type II toxin-antitoxin system HicA family toxin | - |
| HTY61_RS09990 (HTY61_09990) | - | 2038171..2038623 (+) | 453 | WP_175276650.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| HTY61_RS09995 (HTY61_09995) | - | 2038676..2038915 (-) | 240 | WP_175276651.1 | hypothetical protein | - |
| HTY61_RS10000 (HTY61_10000) | - | 2039185..2040276 (+) | 1092 | WP_175276652.1 | autoinducer binding domain-containing protein | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 19034.91 Da Isoelectric Point: 5.4088
>NTDB_id=454816 HTY61_RS09950 WP_175276642.1 2033477..2033986(+) (ssb) [Oricola thermophila strain MEBiC13590]
MAGSVNKVILVGNLGADPDVRRLNSGEPVVNISVATSESWRDKQTGERRERTEWHRVVIFNEHLAKVAEEYLRKGSRVYI
EGQLQSRKWQDQSGQDRYTTEVVLQRFRGELQLLDSSGGAQSRAESQASAYGRGGASGEDELRRQAEERTRQAQQGRGLA
DEMDDEIPF
MAGSVNKVILVGNLGADPDVRRLNSGEPVVNISVATSESWRDKQTGERRERTEWHRVVIFNEHLAKVAEEYLRKGSRVYI
EGQLQSRKWQDQSGQDRYTTEVVLQRFRGELQLLDSSGGAQSRAESQASAYGRGGASGEDELRRQAEERTRQAQQGRGLA
DEMDDEIPF
Nucleotide
Download Length: 510 bp
>NTDB_id=454816 HTY61_RS09950 WP_175276642.1 2033477..2033986(+) (ssb) [Oricola thermophila strain MEBiC13590]
ATGGCCGGATCCGTGAACAAGGTCATCCTCGTCGGCAATCTCGGCGCGGACCCCGATGTCCGCCGCCTGAATTCCGGCGA
GCCCGTCGTCAACATATCCGTCGCGACCTCGGAGAGCTGGCGCGACAAGCAGACAGGCGAGCGCCGCGAGCGCACCGAGT
GGCATCGCGTCGTCATCTTCAACGAGCATCTCGCCAAGGTCGCCGAGGAATATCTGCGCAAGGGATCGCGGGTCTACATC
GAGGGGCAGTTGCAATCCCGCAAGTGGCAGGACCAGTCCGGGCAGGACCGGTACACGACCGAGGTCGTGCTGCAGCGCTT
CCGCGGCGAACTGCAACTGCTCGATTCCTCCGGCGGCGCGCAGAGCCGTGCCGAGAGCCAGGCGTCGGCCTATGGCCGCG
GCGGCGCGTCCGGGGAGGACGAGTTGCGTCGCCAGGCGGAGGAGAGAACCCGGCAGGCGCAACAGGGCCGCGGCCTTGCC
GACGAAATGGATGACGAGATCCCGTTCTAG
ATGGCCGGATCCGTGAACAAGGTCATCCTCGTCGGCAATCTCGGCGCGGACCCCGATGTCCGCCGCCTGAATTCCGGCGA
GCCCGTCGTCAACATATCCGTCGCGACCTCGGAGAGCTGGCGCGACAAGCAGACAGGCGAGCGCCGCGAGCGCACCGAGT
GGCATCGCGTCGTCATCTTCAACGAGCATCTCGCCAAGGTCGCCGAGGAATATCTGCGCAAGGGATCGCGGGTCTACATC
GAGGGGCAGTTGCAATCCCGCAAGTGGCAGGACCAGTCCGGGCAGGACCGGTACACGACCGAGGTCGTGCTGCAGCGCTT
CCGCGGCGAACTGCAACTGCTCGATTCCTCCGGCGGCGCGCAGAGCCGTGCCGAGAGCCAGGCGTCGGCCTATGGCCGCG
GCGGCGCGTCCGGGGAGGACGAGTTGCGTCGCCAGGCGGAGGAGAGAACCCGGCAGGCGCAACAGGGCCGCGGCCTTGCC
GACGAAATGGATGACGAGATCCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
51.323 |
100 |
0.574 |
| ssb | Vibrio cholerae strain A1552 |
51.149 |
100 |
0.527 |
| ssb | Neisseria meningitidis MC58 |
40.782 |
100 |
0.432 |
| ssb | Neisseria gonorrhoeae MS11 |
40.223 |
100 |
0.426 |