Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | HUK71_RS18605 | Genome accession | NZ_CP054790 |
| Coordinates | 3925648..3926145 (+) | Length | 165 a.a. |
| NCBI ID | WP_034010289.1 | Uniprot ID | - |
| Organism | Pseudomonas aeruginosa strain SE5418 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3875502..3937429 | 3925648..3926145 | within | 0 |
Gene organization within MGE regions
Location: 3875502..3937429
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HUK71_RS18380 (HUK71_18330) | - | 3875502..3876095 (-) | 594 | WP_059309552.1 | DUF1737 domain-containing protein | - |
| HUK71_RS18385 (HUK71_18335) | - | 3876106..3876627 (-) | 522 | WP_059309553.1 | hypothetical protein | - |
| HUK71_RS18390 (HUK71_18340) | - | 3876631..3877158 (-) | 528 | WP_059309554.1 | glycoside hydrolase family protein | - |
| HUK71_RS18395 (HUK71_18345) | - | 3877142..3877381 (-) | 240 | WP_004354898.1 | holin | - |
| HUK71_RS18400 (HUK71_32665) | - | 3877494..3888842 (-) | 11349 | WP_235176230.1 | PLxRFG domain-containing protein | - |
| HUK71_RS18405 (HUK71_18365) | - | 3888858..3891029 (-) | 2172 | WP_235175491.1 | hypothetical protein | - |
| HUK71_RS18410 (HUK71_18370) | - | 3891135..3892385 (-) | 1251 | WP_071557749.1 | DnaJ domain-containing protein | - |
| HUK71_RS18415 (HUK71_18375) | - | 3892497..3894389 (-) | 1893 | WP_042931354.1 | hypothetical protein | - |
| HUK71_RS18420 (HUK71_18380) | - | 3894390..3895553 (-) | 1164 | WP_174249850.1 | hypothetical protein | - |
| HUK71_RS18425 (HUK71_18385) | - | 3895546..3898143 (-) | 2598 | WP_124117572.1 | hypothetical protein | - |
| HUK71_RS18430 (HUK71_18390) | - | 3898148..3898738 (-) | 591 | WP_004349221.1 | hypothetical protein | - |
| HUK71_RS18435 (HUK71_18395) | - | 3898806..3899996 (-) | 1191 | WP_033937567.1 | hypothetical protein | - |
| HUK71_RS18440 (HUK71_18400) | - | 3899996..3902959 (-) | 2964 | WP_059309559.1 | hypothetical protein | - |
| HUK71_RS18445 (HUK71_18405) | - | 3902962..3903819 (-) | 858 | WP_004354920.1 | hypothetical protein | - |
| HUK71_RS18450 (HUK71_18410) | - | 3903819..3904151 (-) | 333 | WP_177289652.1 | hypothetical protein | - |
| HUK71_RS18455 (HUK71_18415) | - | 3904268..3904675 (-) | 408 | WP_004349209.1 | hypothetical protein | - |
| HUK71_RS18460 (HUK71_18420) | - | 3904656..3904862 (-) | 207 | WP_004349207.1 | hypothetical protein | - |
| HUK71_RS18465 (HUK71_18425) | - | 3904859..3905536 (-) | 678 | WP_034085194.1 | DUF6682 family protein | - |
| HUK71_RS18470 (HUK71_18430) | - | 3905533..3906405 (-) | 873 | WP_059309560.1 | RyR domain-containing protein | - |
| HUK71_RS18475 (HUK71_18435) | - | 3906470..3906949 (-) | 480 | WP_015975422.1 | hypothetical protein | - |
| HUK71_RS18480 (HUK71_18440) | - | 3907008..3908300 (-) | 1293 | WP_023082376.1 | DUF4043 family protein | - |
| HUK71_RS18485 (HUK71_18445) | - | 3908313..3909443 (-) | 1131 | WP_070147884.1 | hypothetical protein | - |
| HUK71_RS18490 (HUK71_18450) | - | 3909590..3911908 (-) | 2319 | WP_023082375.1 | hypothetical protein | - |
| HUK71_RS18495 (HUK71_18455) | - | 3911918..3913201 (-) | 1284 | WP_023082374.1 | PBSX family phage terminase large subunit | - |
| HUK71_RS32935 | - | 3913198..3913764 (-) | 567 | WP_004349191.1 | hypothetical protein | - |
| HUK71_RS18505 (HUK71_18465) | - | 3913917..3914141 (+) | 225 | WP_023980885.1 | hypothetical protein | - |
| HUK71_RS18510 (HUK71_18470) | - | 3914144..3914638 (-) | 495 | WP_004349189.1 | hypothetical protein | - |
| HUK71_RS18515 (HUK71_18475) | - | 3914717..3915331 (-) | 615 | WP_023082373.1 | recombination protein NinG | - |
| HUK71_RS18520 (HUK71_18480) | - | 3915387..3915938 (-) | 552 | WP_023082372.1 | hypothetical protein | - |
| HUK71_RS18525 (HUK71_18485) | - | 3915931..3916788 (-) | 858 | WP_021264627.1 | hypothetical protein | - |
| HUK71_RS18530 (HUK71_32670) | - | 3916775..3917743 (-) | 969 | WP_004354955.1 | hypothetical protein | - |
| HUK71_RS18535 (HUK71_18495) | - | 3917781..3918020 (-) | 240 | WP_004354958.1 | helix-turn-helix domain-containing protein | - |
| HUK71_RS18540 (HUK71_18500) | - | 3919114..3919287 (+) | 174 | WP_004349171.1 | hypothetical protein | - |
| HUK71_RS18545 (HUK71_18505) | - | 3919567..3919830 (+) | 264 | WP_033991554.1 | hypothetical protein | - |
| HUK71_RS18550 (HUK71_18510) | - | 3919865..3920149 (+) | 285 | WP_017001707.1 | hypothetical protein | - |
| HUK71_RS18555 (HUK71_18515) | - | 3920212..3920424 (+) | 213 | WP_079389642.1 | hypothetical protein | - |
| HUK71_RS18560 (HUK71_18520) | csrA | 3920459..3920830 (+) | 372 | WP_034051764.1 | carbon storage regulator CsrA | - |
| HUK71_RS18565 (HUK71_18525) | - | 3920887..3921456 (-) | 570 | WP_034058628.1 | hypothetical protein | - |
| HUK71_RS18570 (HUK71_18530) | - | 3921598..3921741 (+) | 144 | WP_023091957.1 | hypothetical protein | - |
| HUK71_RS18575 (HUK71_18535) | - | 3921725..3921946 (+) | 222 | WP_023091958.1 | hypothetical protein | - |
| HUK71_RS18580 (HUK71_18540) | - | 3921943..3922314 (+) | 372 | WP_004354971.1 | hypothetical protein | - |
| HUK71_RS18585 (HUK71_18545) | - | 3922427..3922564 (+) | 138 | WP_004354975.1 | hypothetical protein | - |
| HUK71_RS18590 (HUK71_18550) | - | 3922585..3923283 (+) | 699 | WP_023091960.1 | ERF family protein | - |
| HUK71_RS18595 (HUK71_18555) | - | 3923280..3924917 (+) | 1638 | WP_023091961.1 | YqaJ viral recombinase family protein | - |
| HUK71_RS18600 (HUK71_18560) | - | 3925039..3925644 (+) | 606 | WP_034010291.1 | 3'-5' exonuclease | - |
| HUK71_RS18605 (HUK71_18565) | ssb | 3925648..3926145 (+) | 498 | WP_034010289.1 | single-stranded DNA-binding protein | Machinery gene |
| HUK71_RS18610 (HUK71_18570) | rdgC | 3926172..3927089 (+) | 918 | Protein_3684 | recombination-associated protein RdgC | - |
| HUK71_RS18615 (HUK71_32675) | - | 3927201..3927392 (+) | 192 | Protein_3685 | DNA translocase FtsK | - |
| HUK71_RS18620 (HUK71_18575) | - | 3927498..3927812 (-) | 315 | WP_004355019.1 | hypothetical protein | - |
| HUK71_RS18625 (HUK71_18580) | - | 3928040..3928735 (-) | 696 | WP_059309563.1 | hypothetical protein | - |
| HUK71_RS18630 (HUK71_18585) | - | 3928856..3930769 (+) | 1914 | WP_059309564.1 | DNA cytosine methyltransferase | - |
| HUK71_RS18635 (HUK71_18590) | - | 3931126..3931980 (-) | 855 | WP_124117576.1 | DUF3825 domain-containing protein | - |
| HUK71_RS18640 (HUK71_18595) | - | 3932109..3932474 (-) | 366 | WP_124117578.1 | hypothetical protein | - |
| HUK71_RS18645 (HUK71_18600) | - | 3932471..3932938 (-) | 468 | WP_046688615.1 | hypothetical protein | - |
| HUK71_RS18650 (HUK71_18605) | - | 3932990..3933154 (+) | 165 | WP_153603913.1 | hypothetical protein | - |
| HUK71_RS18655 (HUK71_18610) | - | 3933151..3933573 (+) | 423 | WP_020750790.1 | hypothetical protein | - |
| HUK71_RS18660 (HUK71_18615) | - | 3933597..3933758 (+) | 162 | WP_171947427.1 | AlpA family transcriptional regulator | - |
| HUK71_RS18665 (HUK71_32680) | - | 3933831..3934067 (-) | 237 | Protein_3695 | hypothetical protein | - |
| HUK71_RS18670 (HUK71_18620) | - | 3934107..3934649 (-) | 543 | WP_124117580.1 | hypothetical protein | - |
| HUK71_RS18675 (HUK71_18625) | - | 3934636..3934983 (-) | 348 | WP_079386696.1 | STAS-like domain-containing protein | - |
| HUK71_RS18680 (HUK71_18630) | - | 3934989..3936089 (-) | 1101 | WP_124117583.1 | hypothetical protein | - |
| HUK71_RS18685 (HUK71_18635) | - | 3936197..3937429 (-) | 1233 | WP_235200867.1 | integrase arm-type DNA-binding domain-containing protein | - |
Sequence
Protein
Download Length: 165 a.a. Molecular weight: 18519.55 Da Isoelectric Point: 6.9906
>NTDB_id=454600 HUK71_RS18605 WP_034010289.1 3925648..3926145(+) (ssb) [Pseudomonas aeruginosa strain SE5418]
MARGVNKVILVGHLGQDPDARSTPSGKAVTSLSLATSESWKDKQTGQQQERTEWHRVVLFGRLAEIAAQYLRKGSQVYIE
GSLRTRKWQGQDGQDHYSTEVVVDINGNMQLLGGKPEQAGQSRGPGREPPPRPTTHHQPQPATDYDSYDDDIPFDDPYRL
LWRLV
MARGVNKVILVGHLGQDPDARSTPSGKAVTSLSLATSESWKDKQTGQQQERTEWHRVVLFGRLAEIAAQYLRKGSQVYIE
GSLRTRKWQGQDGQDHYSTEVVVDINGNMQLLGGKPEQAGQSRGPGREPPPRPTTHHQPQPATDYDSYDDDIPFDDPYRL
LWRLV
Nucleotide
Download Length: 498 bp
>NTDB_id=454600 HUK71_RS18605 WP_034010289.1 3925648..3926145(+) (ssb) [Pseudomonas aeruginosa strain SE5418]
ATGGCACGCGGAGTGAACAAGGTAATCCTGGTCGGCCATCTGGGCCAGGATCCAGACGCAAGATCTACCCCCAGCGGGAA
GGCAGTTACGTCCCTCAGCCTGGCCACTAGCGAAAGCTGGAAAGACAAGCAGACCGGCCAGCAGCAGGAGCGCACCGAGT
GGCACCGGGTCGTGCTCTTTGGCCGGCTGGCCGAAATCGCAGCGCAATACCTGCGAAAGGGCTCCCAGGTCTACATCGAA
GGCAGCCTACGCACCCGCAAGTGGCAGGGCCAGGACGGCCAGGACCACTACAGCACCGAGGTAGTGGTGGACATCAACGG
CAACATGCAACTGCTCGGCGGCAAGCCTGAGCAGGCAGGCCAGTCGCGTGGCCCTGGCCGCGAGCCGCCACCGCGGCCGA
CCACTCACCACCAGCCGCAACCGGCAACCGACTACGACAGCTACGACGACGACATTCCGTTCGATGACCCCTATCGCCTG
CTCTGGCGTCTCGTGTAA
ATGGCACGCGGAGTGAACAAGGTAATCCTGGTCGGCCATCTGGGCCAGGATCCAGACGCAAGATCTACCCCCAGCGGGAA
GGCAGTTACGTCCCTCAGCCTGGCCACTAGCGAAAGCTGGAAAGACAAGCAGACCGGCCAGCAGCAGGAGCGCACCGAGT
GGCACCGGGTCGTGCTCTTTGGCCGGCTGGCCGAAATCGCAGCGCAATACCTGCGAAAGGGCTCCCAGGTCTACATCGAA
GGCAGCCTACGCACCCGCAAGTGGCAGGGCCAGGACGGCCAGGACCACTACAGCACCGAGGTAGTGGTGGACATCAACGG
CAACATGCAACTGCTCGGCGGCAAGCCTGAGCAGGCAGGCCAGTCGCGTGGCCCTGGCCGCGAGCCGCCACCGCGGCCGA
CCACTCACCACCAGCCGCAACCGGCAACCGACTACGACAGCTACGACGACGACATTCCGTTCGATGACCCCTATCGCCTG
CTCTGGCGTCTCGTGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
53.933 |
100 |
0.582 |
| ssb | Glaesserella parasuis strain SC1401 |
47.514 |
100 |
0.521 |
| ssb | Neisseria meningitidis MC58 |
41.477 |
100 |
0.442 |
| ssb | Neisseria gonorrhoeae MS11 |
41.477 |
100 |
0.442 |