Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   BAXH7_RS12235 Genome accession   NC_017191
Coordinates   2427049..2427486 (-) Length   145 a.a.
NCBI ID   WP_013352869.1    Uniprot ID   A0A9P1JIH3
Organism   Bacillus amyloliquefaciens XH7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2422049..2432486
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAXH7_RS12185 (BAXH7_02580) sinI 2422435..2422608 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  BAXH7_RS12190 (BAXH7_02581) sinR 2422642..2422977 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  BAXH7_RS12195 (BAXH7_02582) tasA 2423025..2423810 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  BAXH7_RS12200 (BAXH7_02583) sipW 2423875..2424459 (-) 585 WP_013352863.1 signal peptidase I SipW -
  BAXH7_RS12205 (BAXH7_02584) tapA 2424431..2425102 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  BAXH7_RS12210 (BAXH7_02585) - 2425360..2425689 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  BAXH7_RS12215 (BAXH7_02586) - 2425730..2425909 (-) 180 WP_013352866.1 YqzE family protein -
  BAXH7_RS12220 (BAXH7_02587) comGG 2425963..2426340 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAXH7_RS12225 (BAXH7_02588) comGF 2426342..2426842 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  BAXH7_RS12230 (BAXH7_02589) comGE 2426751..2427065 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  BAXH7_RS12235 (BAXH7_02590) comGD 2427049..2427486 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAXH7_RS12240 (BAXH7_02591) comGC 2427476..2427742 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  BAXH7_RS12245 (BAXH7_02592) comGB 2427789..2428826 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAXH7_RS12250 (BAXH7_02593) comGA 2428813..2429883 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  BAXH7_RS12255 (BAXH7_02595) - 2430077..2431027 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -
  BAXH7_RS12260 (BAXH7_02596) - 2431174..2432475 (+) 1302 WP_013352874.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16256.71 Da        Isoelectric Point: 9.7141

>NTDB_id=45332 BAXH7_RS12235 WP_013352869.1 2427049..2427486(-) (comGD) [Bacillus amyloliquefaciens XH7]
MNNNRLTENGFTLLESLVVLSLASVLLTVLFTAVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSAGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITIYLGSGNVHAERK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=45332 BAXH7_RS12235 WP_013352869.1 2427049..2427486(-) (comGD) [Bacillus amyloliquefaciens XH7]
TTGAACAATAACCGGCTGACAGAAAACGGATTCACTCTTCTTGAAAGCCTGGTTGTGTTAAGTCTGGCGTCTGTATTGCT
GACTGTTTTGTTCACGGCGGTTCCGCCGGTTTATACCCATCTGGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGACA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACATTTCTCCCAAAAGAGCATAAATACAAG
CTGCAGTCAGCCGGAAGGATTGTTGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCCGGCGGAAAGATTCAATTGAAAAGCGCGGGATTCACTTATGAAATAACAATTT
ACTTAGGGAGCGGAAATGTCCATGCAGAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.115

95.862

0.538


Multiple sequence alignment