Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LL3_RS12685 Genome accession   NC_017190
Coordinates   2508528..2508905 (-) Length   125 a.a.
NCBI ID   WP_013352867.1    Uniprot ID   A0A9P1JIN8
Organism   Bacillus amyloliquefaciens LL3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2503528..2513905
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL3_RS12645 (LL3_02655) - 2504026..2504820 (+) 795 WP_014472099.1 YqhG family protein -
  LL3_RS12650 (LL3_02657) sinI 2505000..2505173 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  LL3_RS12655 (LL3_02658) sinR 2505207..2505542 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  LL3_RS12660 (LL3_02659) tasA 2505590..2506375 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  LL3_RS12665 (LL3_02660) sipW 2506440..2507024 (-) 585 WP_013352863.1 signal peptidase I SipW -
  LL3_RS12670 (LL3_02661) tapA 2506996..2507667 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  LL3_RS12675 (LL3_02662) - 2507925..2508254 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  LL3_RS12680 (LL3_02663) - 2508295..2508474 (-) 180 WP_013352866.1 YqzE family protein -
  LL3_RS12685 (LL3_02664) comGG 2508528..2508905 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL3_RS12690 (LL3_02665) comGF 2508907..2509407 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  LL3_RS12695 (LL3_02666) comGE 2509316..2509630 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL3_RS12700 (LL3_02667) comGD 2509614..2510051 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  LL3_RS12705 (LL3_02668) comGC 2510041..2510307 (-) 267 WP_044051905.1 competence type IV pilus major pilin ComGC Machinery gene
  LL3_RS12710 (LL3_02669) comGB 2510354..2511391 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  LL3_RS12715 (LL3_02670) comGA 2511378..2512448 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  LL3_RS12720 (LL3_02672) - 2512642..2513592 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.18 Da        Isoelectric Point: 10.2027

>NTDB_id=45255 LL3_RS12685 WP_013352867.1 2508528..2508905(-) (comGG) [Bacillus amyloliquefaciens LL3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMIQGQKTQSGTQRFPYGTVS
FYINGNDRRETVQVTIKAVTASGTRREAHLLFNHKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=45255 LL3_RS12685 WP_013352867.1 2508528..2508905(-) (comGG) [Bacillus amyloliquefaciens LL3]
ATGTACAAATCTGACGGGTTTATATATCCGGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGTGAGAACCTGCTTCAAAACGGCG
CACTGCTGTCAAGCCGTCATATGATACAGGGACAAAAGACTCAGTCGGGCACACAGCGTTTTCCGTACGGAACCGTCTCC
TTTTACATCAACGGGAACGATCGCCGGGAAACGGTTCAAGTTACAATAAAGGCGGTAACAGCATCAGGGACGAGACGGGA
GGCTCACCTTTTATTCAATCATAAGAAGAAACAGCTGATTCAATGGACAGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment