Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   LL3_RS12650 Genome accession   NC_017190
Coordinates   2505000..2505173 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens LL3     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2500000..2510173
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LL3_RS12635 (LL3_02653) gcvT 2500811..2501911 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  LL3_RS12640 (LL3_02654) - 2502335..2504005 (+) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  LL3_RS12645 (LL3_02655) - 2504026..2504820 (+) 795 WP_014472099.1 YqhG family protein -
  LL3_RS12650 (LL3_02657) sinI 2505000..2505173 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  LL3_RS12655 (LL3_02658) sinR 2505207..2505542 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  LL3_RS12660 (LL3_02659) tasA 2505590..2506375 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  LL3_RS12665 (LL3_02660) sipW 2506440..2507024 (-) 585 WP_013352863.1 signal peptidase I SipW -
  LL3_RS12670 (LL3_02661) tapA 2506996..2507667 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  LL3_RS12675 (LL3_02662) - 2507925..2508254 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  LL3_RS12680 (LL3_02663) - 2508295..2508474 (-) 180 WP_013352866.1 YqzE family protein -
  LL3_RS12685 (LL3_02664) comGG 2508528..2508905 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  LL3_RS12690 (LL3_02665) comGF 2508907..2509407 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  LL3_RS12695 (LL3_02666) comGE 2509316..2509630 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  LL3_RS12700 (LL3_02667) comGD 2509614..2510051 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=45253 LL3_RS12650 WP_013352860.1 2505000..2505173(+) (sinI) [Bacillus amyloliquefaciens LL3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=45253 LL3_RS12650 WP_013352860.1 2505000..2505173(+) (sinI) [Bacillus amyloliquefaciens LL3]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684


Multiple sequence alignment