Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LL3_RS12650 | Genome accession | NC_017190 |
| Coordinates | 2505000..2505173 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens LL3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2500000..2510173
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL3_RS12635 (LL3_02653) | gcvT | 2500811..2501911 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LL3_RS12640 (LL3_02654) | - | 2502335..2504005 (+) | 1671 | WP_014470658.1 | DEAD/DEAH box helicase | - |
| LL3_RS12645 (LL3_02655) | - | 2504026..2504820 (+) | 795 | WP_014472099.1 | YqhG family protein | - |
| LL3_RS12650 (LL3_02657) | sinI | 2505000..2505173 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| LL3_RS12655 (LL3_02658) | sinR | 2505207..2505542 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| LL3_RS12660 (LL3_02659) | tasA | 2505590..2506375 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| LL3_RS12665 (LL3_02660) | sipW | 2506440..2507024 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| LL3_RS12670 (LL3_02661) | tapA | 2506996..2507667 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LL3_RS12675 (LL3_02662) | - | 2507925..2508254 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| LL3_RS12680 (LL3_02663) | - | 2508295..2508474 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| LL3_RS12685 (LL3_02664) | comGG | 2508528..2508905 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LL3_RS12690 (LL3_02665) | comGF | 2508907..2509407 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| LL3_RS12695 (LL3_02666) | comGE | 2509316..2509630 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LL3_RS12700 (LL3_02667) | comGD | 2509614..2510051 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=45253 LL3_RS12650 WP_013352860.1 2505000..2505173(+) (sinI) [Bacillus amyloliquefaciens LL3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=45253 LL3_RS12650 WP_013352860.1 2505000..2505173(+) (sinI) [Bacillus amyloliquefaciens LL3]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |