Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   HTY60_RS12615 Genome accession   NZ_CP054415
Coordinates   2449145..2449459 (-) Length   104 a.a.
NCBI ID   WP_014470662.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain 205     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2444145..2454459
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HTY60_RS12570 (HTY60_12570) sinI 2444829..2445002 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  HTY60_RS12575 (HTY60_12575) sinR 2445036..2445371 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  HTY60_RS12580 (HTY60_12580) tasA 2445419..2446204 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  HTY60_RS12585 (HTY60_12585) sipW 2446269..2446853 (-) 585 WP_013352863.1 signal peptidase I SipW -
  HTY60_RS12590 (HTY60_12590) tapA 2446825..2447496 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  HTY60_RS12595 (HTY60_12595) - 2447754..2448083 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  HTY60_RS12600 (HTY60_12600) - 2448124..2448303 (-) 180 WP_013352866.1 YqzE family protein -
  HTY60_RS12605 (HTY60_12605) comGG 2448357..2448734 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  HTY60_RS12610 (HTY60_12610) comGF 2448736..2449236 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  HTY60_RS12615 (HTY60_12615) comGE 2449145..2449459 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  HTY60_RS12620 (HTY60_12620) comGD 2449443..2449880 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene
  HTY60_RS12625 (HTY60_12625) comGC 2449870..2450178 (-) 309 WP_013352870.1 competence type IV pilus major pilin ComGC Machinery gene
  HTY60_RS12630 (HTY60_12630) comGB 2450183..2451220 (-) 1038 WP_013352871.1 competence type IV pilus assembly protein ComGB Machinery gene
  HTY60_RS12635 (HTY60_12635) comGA 2451207..2452277 (-) 1071 WP_013352872.1 competence type IV pilus ATPase ComGA Machinery gene
  HTY60_RS12640 (HTY60_12640) - 2452471..2453421 (-) 951 WP_013352873.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11934.89 Da        Isoelectric Point: 6.2120

>NTDB_id=452316 HTY60_RS12615 WP_014470662.1 2449145..2449459(-) (comGE) [Bacillus amyloliquefaciens strain 205]
MQNGNKGFSTIETLSAMAIWLFLMISIVPVWTGMLTDNLKIEEHQEVYQLLHKHISAYMMSGKKQPSPDVTWKEDGDYYK
VCAAVRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=452316 HTY60_RS12615 WP_014470662.1 2449145..2449459(-) (comGE) [Bacillus amyloliquefaciens strain 205]
ATGCAGAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCTATTTGGCTGTTCCTTATGATTTCTAT
CGTTCCGGTCTGGACGGGCATGCTGACAGACAATCTGAAAATAGAAGAACACCAGGAAGTGTACCAGCTTCTTCATAAAC
ATATCAGCGCATATATGATGTCCGGAAAAAAGCAGCCATCTCCCGATGTGACGTGGAAGGAGGATGGTGATTATTACAAA
GTCTGTGCAGCTGTCCGCGGCGAAAAAGAAATGTGCCTCAGCATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481