Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | HTY60_RS12570 | Genome accession | NZ_CP054415 |
| Coordinates | 2444829..2445002 (+) | Length | 57 a.a. |
| NCBI ID | WP_013352860.1 | Uniprot ID | A0A9P1JIA1 |
| Organism | Bacillus amyloliquefaciens strain 205 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2439829..2450002
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HTY60_RS12555 (HTY60_12555) | gcvT | 2440640..2441740 (-) | 1101 | WP_013352857.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| HTY60_RS12560 (HTY60_12560) | - | 2442164..2443834 (+) | 1671 | WP_014470658.1 | DEAD/DEAH box helicase | - |
| HTY60_RS12565 (HTY60_12565) | - | 2443855..2444649 (+) | 795 | WP_013352859.1 | YqhG family protein | - |
| HTY60_RS12570 (HTY60_12570) | sinI | 2444829..2445002 (+) | 174 | WP_013352860.1 | anti-repressor SinI | Regulator |
| HTY60_RS12575 (HTY60_12575) | sinR | 2445036..2445371 (+) | 336 | WP_014470659.1 | transcriptional regulator SinR | Regulator |
| HTY60_RS12580 (HTY60_12580) | tasA | 2445419..2446204 (-) | 786 | WP_013352862.1 | biofilm matrix protein TasA | - |
| HTY60_RS12585 (HTY60_12585) | sipW | 2446269..2446853 (-) | 585 | WP_013352863.1 | signal peptidase I SipW | - |
| HTY60_RS12590 (HTY60_12590) | tapA | 2446825..2447496 (-) | 672 | WP_013352864.1 | amyloid fiber anchoring/assembly protein TapA | - |
| HTY60_RS12595 (HTY60_12595) | - | 2447754..2448083 (+) | 330 | WP_013352865.1 | DUF3889 domain-containing protein | - |
| HTY60_RS12600 (HTY60_12600) | - | 2448124..2448303 (-) | 180 | WP_013352866.1 | YqzE family protein | - |
| HTY60_RS12605 (HTY60_12605) | comGG | 2448357..2448734 (-) | 378 | WP_013352867.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| HTY60_RS12610 (HTY60_12610) | comGF | 2448736..2449236 (-) | 501 | WP_013352868.1 | competence type IV pilus minor pilin ComGF | - |
| HTY60_RS12615 (HTY60_12615) | comGE | 2449145..2449459 (-) | 315 | WP_014470662.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| HTY60_RS12620 (HTY60_12620) | comGD | 2449443..2449880 (-) | 438 | WP_013352869.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6689.61 Da Isoelectric Point: 9.8173
>NTDB_id=452313 HTY60_RS12570 WP_013352860.1 2444829..2445002(+) (sinI) [Bacillus amyloliquefaciens strain 205]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=452313 HTY60_RS12570 WP_013352860.1 2444829..2445002(+) (sinI) [Bacillus amyloliquefaciens strain 205]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
68.421 |
100 |
0.684 |