Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   HTY60_RS12570 Genome accession   NZ_CP054415
Coordinates   2444829..2445002 (+) Length   57 a.a.
NCBI ID   WP_013352860.1    Uniprot ID   A0A9P1JIA1
Organism   Bacillus amyloliquefaciens strain 205     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2439829..2450002
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HTY60_RS12555 (HTY60_12555) gcvT 2440640..2441740 (-) 1101 WP_013352857.1 glycine cleavage system aminomethyltransferase GcvT -
  HTY60_RS12560 (HTY60_12560) - 2442164..2443834 (+) 1671 WP_014470658.1 DEAD/DEAH box helicase -
  HTY60_RS12565 (HTY60_12565) - 2443855..2444649 (+) 795 WP_013352859.1 YqhG family protein -
  HTY60_RS12570 (HTY60_12570) sinI 2444829..2445002 (+) 174 WP_013352860.1 anti-repressor SinI Regulator
  HTY60_RS12575 (HTY60_12575) sinR 2445036..2445371 (+) 336 WP_014470659.1 transcriptional regulator SinR Regulator
  HTY60_RS12580 (HTY60_12580) tasA 2445419..2446204 (-) 786 WP_013352862.1 biofilm matrix protein TasA -
  HTY60_RS12585 (HTY60_12585) sipW 2446269..2446853 (-) 585 WP_013352863.1 signal peptidase I SipW -
  HTY60_RS12590 (HTY60_12590) tapA 2446825..2447496 (-) 672 WP_013352864.1 amyloid fiber anchoring/assembly protein TapA -
  HTY60_RS12595 (HTY60_12595) - 2447754..2448083 (+) 330 WP_013352865.1 DUF3889 domain-containing protein -
  HTY60_RS12600 (HTY60_12600) - 2448124..2448303 (-) 180 WP_013352866.1 YqzE family protein -
  HTY60_RS12605 (HTY60_12605) comGG 2448357..2448734 (-) 378 WP_013352867.1 competence type IV pilus minor pilin ComGG Machinery gene
  HTY60_RS12610 (HTY60_12610) comGF 2448736..2449236 (-) 501 WP_013352868.1 competence type IV pilus minor pilin ComGF -
  HTY60_RS12615 (HTY60_12615) comGE 2449145..2449459 (-) 315 WP_014470662.1 competence type IV pilus minor pilin ComGE Machinery gene
  HTY60_RS12620 (HTY60_12620) comGD 2449443..2449880 (-) 438 WP_013352869.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6689.61 Da        Isoelectric Point: 9.8173

>NTDB_id=452313 HTY60_RS12570 WP_013352860.1 2444829..2445002(+) (sinI) [Bacillus amyloliquefaciens strain 205]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLHSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=452313 HTY60_RS12570 WP_013352860.1 2444829..2445002(+) (sinI) [Bacillus amyloliquefaciens strain 205]
ATGAAAAATGCAAAAACAGAGTTTTCGCAATTAGATAAGGAATGGGTTGAACTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAGATACGCAAATACCTGCATTCGCATAAAAAGTCTTCTCAACATATCCAGGCCGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

68.421

100

0.684