Detailed information
Bioinformatically predicted
Overview
| Name | covR | Type | Regulator |
| Locus tag | FOC63_RS01720 | Genome accession | NZ_CP054015 |
| Coordinates | 353769..354461 (-) | Length | 230 a.a. |
| NCBI ID | WP_009854820.1 | Uniprot ID | A0A139QWD3 |
| Organism | Streptococcus gallolyticus strain FDAARGOS_755 | ||
| Function | repress comR expression (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 293394..378490 | 353769..354461 | within | 0 |
Gene organization within MGE regions
Location: 293394..378490
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC63_RS01415 (FOC63_01415) | clpP | 293823..294413 (-) | 591 | WP_003066032.1 | ATP-dependent Clp protease proteolytic subunit ClpP | Regulator |
| FOC63_RS01420 (FOC63_01420) | - | 294545..295438 (-) | 894 | WP_009854763.1 | DMT family transporter | - |
| FOC63_RS01425 (FOC63_01425) | - | 295551..296420 (+) | 870 | WP_009854764.1 | LysR family transcriptional regulator | - |
| FOC63_RS01430 (FOC63_01430) | upp | 296486..297115 (-) | 630 | WP_003066034.1 | uracil phosphoribosyltransferase | - |
| FOC63_RS01435 (FOC63_01435) | - | 297273..298436 (-) | 1164 | WP_009854765.1 | MalY/PatB family protein | - |
| FOC63_RS01440 (FOC63_01440) | - | 298438..299532 (-) | 1095 | WP_009854766.1 | cystathionine gamma-synthase | - |
| FOC63_RS01445 (FOC63_01445) | - | 299831..301465 (-) | 1635 | WP_009854767.1 | putative polysaccharide biosynthesis protein | - |
| FOC63_RS01450 (FOC63_01450) | - | 301562..303013 (+) | 1452 | WP_009854768.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase | - |
| FOC63_RS01455 (FOC63_01455) | - | 303190..303972 (+) | 783 | WP_009854769.1 | ABC transporter ATP-binding protein | - |
| FOC63_RS01460 (FOC63_01460) | - | 303994..304926 (+) | 933 | WP_009854770.1 | ABC transporter substrate-binding protein | - |
| FOC63_RS01465 (FOC63_01465) | - | 305004..306026 (+) | 1023 | WP_009854771.1 | FecCD family ABC transporter permease | - |
| FOC63_RS01470 (FOC63_01470) | - | 306023..307024 (+) | 1002 | WP_043878595.1 | FecCD family ABC transporter permease | - |
| FOC63_RS01475 (FOC63_01475) | - | 307145..307801 (-) | 657 | WP_009854773.1 | DUF1803 domain-containing protein | - |
| FOC63_RS01480 (FOC63_01480) | - | 307794..308309 (-) | 516 | WP_009854774.1 | YiiX/YebB-like N1pC/P60 family cysteine hydrolase | - |
| FOC63_RS01485 (FOC63_01485) | yaaA | 308419..309150 (+) | 732 | WP_009854775.1 | peroxide stress protein YaaA | - |
| FOC63_RS01490 (FOC63_01490) | - | 309228..309371 (-) | 144 | WP_009854776.1 | hypothetical protein | - |
| FOC63_RS01495 (FOC63_01495) | - | 309436..310368 (-) | 933 | WP_009854777.1 | manganese-dependent inorganic pyrophosphatase | - |
| FOC63_RS01500 (FOC63_01500) | - | 310518..311165 (-) | 648 | WP_009854778.1 | hypothetical protein | - |
| FOC63_RS01505 (FOC63_01505) | pflA | 311220..312008 (-) | 789 | WP_009854779.1 | pyruvate formate-lyase-activating protein | - |
| FOC63_RS01510 (FOC63_01510) | - | 312082..313413 (-) | 1332 | WP_009854780.1 | hemolysin family protein | - |
| FOC63_RS01515 (FOC63_01515) | - | 313623..314411 (+) | 789 | WP_009854781.1 | ABC transporter ATP-binding protein | - |
| FOC63_RS01520 (FOC63_01520) | - | 314446..316470 (-) | 2025 | WP_009854782.1 | cation:proton antiporter | - |
| FOC63_RS01525 (FOC63_01525) | - | 316520..316774 (-) | 255 | WP_009854783.1 | hypothetical protein | - |
| FOC63_RS01530 (FOC63_01530) | - | 316780..317343 (-) | 564 | WP_003066074.1 | tRNA (mnm(5)s(2)U34)-methyltransferase | - |
| FOC63_RS01535 (FOC63_01535) | - | 317340..318281 (-) | 942 | WP_009854784.1 | TIGR01212 family radical SAM protein | - |
| FOC63_RS01540 (FOC63_01540) | - | 318403..319059 (-) | 657 | WP_009854785.1 | phosphatase PAP2 family protein | - |
| FOC63_RS01545 (FOC63_01545) | - | 319181..319594 (-) | 414 | WP_009854786.1 | EamA family transporter | - |
| FOC63_RS01550 (FOC63_01550) | - | 319683..320252 (-) | 570 | WP_009854787.1 | ECF transporter S component | - |
| FOC63_RS01555 (FOC63_01555) | - | 320683..321228 (-) | 546 | WP_009854788.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| FOC63_RS01560 (FOC63_01560) | - | 321630..322385 (-) | 756 | WP_012962398.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| FOC63_RS01565 (FOC63_01565) | - | 322586..322948 (+) | 363 | WP_009854790.1 | MerR family transcriptional regulator | - |
| FOC63_RS01570 (FOC63_01570) | - | 323391..325238 (-) | 1848 | WP_009854791.1 | APC family permease | - |
| FOC63_RS01575 (FOC63_01575) | trkA | 325496..326845 (+) | 1350 | WP_009854792.1 | Trk system potassium transporter TrkA | - |
| FOC63_RS01580 (FOC63_01580) | - | 326849..328288 (+) | 1440 | WP_009854793.1 | TrkH family potassium uptake protein | - |
| FOC63_RS01585 (FOC63_01585) | yidD | 328309..328569 (-) | 261 | WP_012962401.1 | membrane protein insertion efficiency factor YidD | - |
| FOC63_RS01590 (FOC63_01590) | - | 328569..329294 (-) | 726 | WP_009854795.1 | pseudouridine synthase | - |
| FOC63_RS01595 (FOC63_01595) | scpB | 329376..329942 (-) | 567 | WP_009854796.1 | SMC-Scp complex subunit ScpB | - |
| FOC63_RS01600 (FOC63_01600) | - | 329998..330702 (-) | 705 | WP_009854797.1 | segregation/condensation protein A | - |
| FOC63_RS01605 (FOC63_01605) | xerD | 330702..331442 (-) | 741 | WP_009854798.1 | site-specific tyrosine recombinase XerD | - |
| FOC63_RS01610 (FOC63_01610) | cbpB | 331435..331902 (-) | 468 | WP_009854799.1 | cyclic-di-AMP-binding protein CbpB | - |
| FOC63_RS01615 (FOC63_01615) | - | 331899..332420 (-) | 522 | WP_009854800.1 | metallophosphoesterase | - |
| FOC63_RS01620 (FOC63_01620) | - | 332402..333418 (-) | 1017 | WP_009854801.1 | nucleoside-triphosphate diphosphatase | - |
| FOC63_RS01625 (FOC63_01625) | racE | 333436..334245 (-) | 810 | WP_009854802.1 | glutamate racemase | - |
| FOC63_RS01630 (FOC63_01630) | - | 334418..334660 (-) | 243 | WP_012962405.1 | YneF family protein | - |
| FOC63_RS01635 (FOC63_01635) | - | 334833..336077 (-) | 1245 | WP_043878596.1 | diaminopimelate decarboxylase | - |
| FOC63_RS01640 (FOC63_01640) | - | 336205..336897 (-) | 693 | WP_009854805.1 | Bax inhibitor-1/YccA family protein | - |
| FOC63_RS01645 (FOC63_01645) | - | 336946..337449 (-) | 504 | WP_009854806.1 | HD domain-containing protein | - |
| FOC63_RS01650 (FOC63_01650) | - | 337549..338289 (-) | 741 | WP_009854807.1 | TrmH family RNA methyltransferase | - |
| FOC63_RS01655 (FOC63_01655) | - | 338325..338603 (+) | 279 | WP_009854808.1 | acylphosphatase | - |
| FOC63_RS01660 (FOC63_01660) | yidC | 338693..339613 (+) | 921 | WP_009854809.1 | membrane protein insertase YidC | - |
| FOC63_RS01665 (FOC63_01665) | greA | 339704..340186 (-) | 483 | WP_003066170.1 | transcription elongation factor GreA | - |
| FOC63_RS01670 (FOC63_01670) | mltG | 340270..341973 (-) | 1704 | WP_009854810.1 | endolytic transglycosylase MltG | - |
| FOC63_RS01675 (FOC63_01675) | - | 342071..342565 (-) | 495 | WP_009854811.1 | GNAT family N-acetyltransferase | - |
| FOC63_RS01680 (FOC63_01680) | murC | 342618..343949 (-) | 1332 | WP_009854812.1 | UDP-N-acetylmuramate--L-alanine ligase | - |
| FOC63_RS01685 (FOC63_01685) | - | 343984..344580 (-) | 597 | WP_009854813.1 | hypothetical protein | - |
| FOC63_RS01690 (FOC63_01690) | - | 344850..347939 (-) | 3090 | WP_043878597.1 | DEAD/DEAH box helicase | - |
| FOC63_RS01695 (FOC63_01695) | der | 348083..349393 (-) | 1311 | WP_009854815.1 | ribosome biogenesis GTPase Der | - |
| FOC63_RS01700 (FOC63_01700) | dnaI | 349545..350447 (-) | 903 | WP_009854816.1 | primosomal protein DnaI | - |
| FOC63_RS01705 (FOC63_01705) | - | 350458..351615 (-) | 1158 | WP_009854817.1 | DnaD domain protein | - |
| FOC63_RS01710 (FOC63_01710) | nrdR | 351599..352096 (-) | 498 | WP_009854818.1 | transcriptional regulator NrdR | - |
| FOC63_RS01715 (FOC63_01715) | - | 352285..353769 (-) | 1485 | WP_009854819.1 | sensor histidine kinase | - |
| FOC63_RS01720 (FOC63_01720) | covR | 353769..354461 (-) | 693 | WP_009854820.1 | response regulator transcription factor | Regulator |
| FOC63_RS01725 (FOC63_01725) | - | 354863..356080 (-) | 1218 | WP_001291561.1 | tyrosine-type recombinase/integrase | - |
| FOC63_RS01730 (FOC63_01730) | - | 356162..356365 (-) | 204 | WP_000814511.1 | excisionase | - |
| FOC63_RS11285 | - | 356349..356600 (+) | 252 | WP_001845478.1 | hypothetical protein | - |
| FOC63_RS01735 (FOC63_01735) | - | 356826..357056 (-) | 231 | WP_000857133.1 | helix-turn-helix domain-containing protein | - |
| FOC63_RS01740 (FOC63_01740) | - | 357053..357475 (-) | 423 | WP_009854821.1 | sigma-70 family RNA polymerase sigma factor | - |
| FOC63_RS01745 (FOC63_01745) | - | 357980..358333 (+) | 354 | WP_001227347.1 | helix-turn-helix transcriptional regulator | - |
| FOC63_RS01750 (FOC63_01750) | - | 358393..358560 (-) | 168 | WP_000336323.1 | cysteine-rich KTR domain-containing protein | - |
| FOC63_RS01755 (FOC63_01755) | tet(M) | 358679..360598 (-) | 1920 | WP_000691727.1 | tetracycline resistance ribosomal protection protein Tet(M) | - |
| FOC63_RS11405 | - | 360614..360661 (-) | 48 | Protein_351 | hypothetical protein | - |
| FOC63_RS01765 (FOC63_01765) | - | 360975..361907 (-) | 933 | WP_001224319.1 | conjugal transfer protein | - |
| FOC63_RS01770 (FOC63_01770) | - | 361904..362905 (-) | 1002 | WP_009854822.1 | lysozyme family protein | - |
| FOC63_RS01775 (FOC63_01775) | - | 362902..365079 (-) | 2178 | WP_000804748.1 | CD3337/EF1877 family mobilome membrane protein | - |
| FOC63_RS01780 (FOC63_01780) | - | 365082..367529 (-) | 2448 | WP_000331160.1 | ATP-binding protein | - |
| FOC63_RS01785 (FOC63_01785) | - | 367513..367905 (-) | 393 | WP_000723888.1 | conjugal transfer protein | - |
| FOC63_RS01790 (FOC63_01790) | - | 367994..368491 (-) | 498 | WP_000342539.1 | antirestriction protein ArdA | - |
| FOC63_RS01795 (FOC63_01795) | - | 368608..368829 (-) | 222 | WP_001009056.1 | hypothetical protein | - |
| FOC63_RS01800 (FOC63_01800) | mobT | 368872..370077 (-) | 1206 | WP_000398284.1 | MobT family relaxase | - |
| FOC63_RS01805 (FOC63_01805) | - | 370100..370252 (-) | 153 | WP_000879507.1 | hypothetical protein | - |
| FOC63_RS01810 (FOC63_01810) | - | 370255..371640 (-) | 1386 | WP_000813488.1 | FtsK/SpoIIIE domain-containing protein | - |
| FOC63_RS01815 (FOC63_01815) | - | 371669..372055 (-) | 387 | WP_000985015.1 | YdcP family protein | - |
| FOC63_RS01820 (FOC63_01820) | - | 372071..372385 (-) | 315 | WP_000420682.1 | YdcP family protein | - |
| FOC63_RS01825 (FOC63_01825) | - | 372737..373273 (-) | 537 | WP_043878598.1 | DUF177 domain-containing protein | - |
| FOC63_RS01830 (FOC63_01830) | htpX | 373415..374317 (-) | 903 | WP_009854824.1 | zinc metalloprotease HtpX | - |
| FOC63_RS01835 (FOC63_01835) | - | 374444..374995 (-) | 552 | WP_012962418.1 | LemA family protein | - |
| FOC63_RS01840 (FOC63_01840) | rsmG | 375326..376039 (+) | 714 | WP_009854826.1 | 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG | - |
| FOC63_RS01845 (FOC63_01845) | - | 376109..377482 (+) | 1374 | WP_009854827.1 | TrkH family potassium uptake protein | - |
| FOC63_RS01850 (FOC63_01850) | ktrA | 377494..378165 (+) | 672 | WP_009854828.1 | potassium uptake transporter gating subunit KtrA | - |
Sequence
Protein
Download Length: 230 a.a. Molecular weight: 26487.39 Da Isoelectric Point: 4.7059
>NTDB_id=450122 FOC63_RS01720 WP_009854820.1 353769..354461(-) (covR) [Streptococcus gallolyticus strain FDAARGOS_755]
MSKKILIIEDEKNLARFVSLELQHEGYSVVVETNGRLGLQTALDDDFDLILLDLMLPDMDGFEITRRLRLEKETSIIMMT
ARDSIMDIVAGLDRGADDYIVKPFAIEELLARVRAVFRRQDVESKREQDSQGKEGLLGLRLNPQNRSAVRGDDEISLTKR
EYDLLSVLLSNVNRVMTREELLASVWRYDTDIETNVVDVYIRYLRGKVDIPGKESYIQTVRGMGYIIREK
MSKKILIIEDEKNLARFVSLELQHEGYSVVVETNGRLGLQTALDDDFDLILLDLMLPDMDGFEITRRLRLEKETSIIMMT
ARDSIMDIVAGLDRGADDYIVKPFAIEELLARVRAVFRRQDVESKREQDSQGKEGLLGLRLNPQNRSAVRGDDEISLTKR
EYDLLSVLLSNVNRVMTREELLASVWRYDTDIETNVVDVYIRYLRGKVDIPGKESYIQTVRGMGYIIREK
Nucleotide
Download Length: 693 bp
>NTDB_id=450122 FOC63_RS01720 WP_009854820.1 353769..354461(-) (covR) [Streptococcus gallolyticus strain FDAARGOS_755]
ATGAGTAAAAAGATTTTAATTATTGAAGATGAAAAAAATCTTGCACGCTTTGTGTCTTTGGAGTTACAACATGAAGGTTA
TTCTGTAGTTGTAGAAACAAACGGGCGCTTAGGGCTTCAAACGGCTCTTGATGACGATTTTGACTTGATTTTGCTTGATT
TAATGCTTCCAGATATGGATGGATTTGAAATCACGCGTCGTCTTCGATTGGAAAAAGAAACTTCTATTATTATGATGACA
GCTCGCGACTCTATTATGGATATTGTTGCTGGGCTTGATCGTGGTGCAGATGACTATATTGTCAAACCATTTGCAATTGA
AGAACTCTTGGCTCGTGTTCGTGCTGTTTTCCGCCGTCAAGATGTTGAATCTAAACGTGAACAAGACAGTCAAGGAAAAG
AAGGATTGCTTGGTCTACGCTTAAATCCTCAAAATCGTTCGGCGGTTCGAGGTGATGATGAAATTTCGCTTACAAAACGT
GAGTACGATTTGTTAAGTGTTCTTTTGTCAAATGTTAATCGTGTAATGACACGTGAAGAACTGCTAGCCAGTGTTTGGAG
ATACGATACAGATATTGAGACAAATGTTGTTGATGTTTATATCCGTTACCTTCGCGGAAAAGTCGATATTCCAGGTAAAG
AATCTTACATTCAAACAGTTCGTGGAATGGGATACATTATTCGAGAAAAATAA
ATGAGTAAAAAGATTTTAATTATTGAAGATGAAAAAAATCTTGCACGCTTTGTGTCTTTGGAGTTACAACATGAAGGTTA
TTCTGTAGTTGTAGAAACAAACGGGCGCTTAGGGCTTCAAACGGCTCTTGATGACGATTTTGACTTGATTTTGCTTGATT
TAATGCTTCCAGATATGGATGGATTTGAAATCACGCGTCGTCTTCGATTGGAAAAAGAAACTTCTATTATTATGATGACA
GCTCGCGACTCTATTATGGATATTGTTGCTGGGCTTGATCGTGGTGCAGATGACTATATTGTCAAACCATTTGCAATTGA
AGAACTCTTGGCTCGTGTTCGTGCTGTTTTCCGCCGTCAAGATGTTGAATCTAAACGTGAACAAGACAGTCAAGGAAAAG
AAGGATTGCTTGGTCTACGCTTAAATCCTCAAAATCGTTCGGCGGTTCGAGGTGATGATGAAATTTCGCTTACAAAACGT
GAGTACGATTTGTTAAGTGTTCTTTTGTCAAATGTTAATCGTGTAATGACACGTGAAGAACTGCTAGCCAGTGTTTGGAG
ATACGATACAGATATTGAGACAAATGTTGTTGATGTTTATATCCGTTACCTTCGCGGAAAAGTCGATATTCCAGGTAAAG
AATCTTACATTCAAACAGTTCGTGGAATGGGATACATTATTCGAGAAAAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| covR | Streptococcus salivarius strain HSISS4 |
75.217 |
100 |
0.752 |
| covR | Lactococcus lactis subsp. lactis strain DGCC12653 |
63.755 |
99.565 |
0.635 |
| vicR | Streptococcus mutans UA159 |
42.857 |
100 |
0.43 |
| micA | Streptococcus pneumoniae Cp1015 |
42.174 |
100 |
0.422 |