Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FOC61_RS12085 | Genome accession | NZ_CP053957 |
| Coordinates | 2450710..2451219 (-) | Length | 169 a.a. |
| NCBI ID | WP_002434425.1 | Uniprot ID | - |
| Organism | Staphylococcus capitis strain FDAARGOS_753 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2418323..2457686 | 2450710..2451219 | within | 0 |
Gene organization within MGE regions
Location: 2418323..2457686
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC61_RS11880 (FOC61_11890) | - | 2418323..2418892 (-) | 570 | WP_002454456.1 | terminase small subunit | - |
| FOC61_RS11885 (FOC61_11895) | - | 2418931..2419146 (-) | 216 | WP_002454455.1 | hypothetical protein | - |
| FOC61_RS11890 (FOC61_11900) | - | 2419146..2419733 (-) | 588 | WP_002454454.1 | pathogenicity island protein | - |
| FOC61_RS11895 (FOC61_11905) | - | 2419748..2420482 (-) | 735 | WP_002454453.1 | hypothetical protein | - |
| FOC61_RS11900 (FOC61_11910) | - | 2420510..2420842 (-) | 333 | WP_002454452.1 | hypothetical protein | - |
| FOC61_RS11905 (FOC61_11915) | - | 2421206..2421850 (-) | 645 | WP_002454451.1 | pathogenicity island protein | - |
| FOC61_RS11910 (FOC61_11920) | - | 2422103..2422924 (-) | 822 | WP_002454449.1 | bifunctional DNA primase/polymerase | - |
| FOC61_RS11915 (FOC61_11925) | - | 2423095..2424708 (-) | 1614 | WP_002454448.1 | hypothetical protein | - |
| FOC61_RS11920 (FOC61_11930) | - | 2424792..2425052 (-) | 261 | WP_002454447.1 | hypothetical protein | - |
| FOC61_RS11925 (FOC61_11935) | - | 2425052..2425471 (-) | 420 | WP_002454446.1 | hypothetical protein | - |
| FOC61_RS11930 (FOC61_11940) | - | 2425473..2425610 (-) | 138 | WP_172848605.1 | hypothetical protein | - |
| FOC61_RS11935 (FOC61_11945) | - | 2425626..2425898 (-) | 273 | WP_002454445.1 | helix-turn-helix domain-containing protein | - |
| FOC61_RS11940 (FOC61_11950) | - | 2425899..2426111 (-) | 213 | WP_002454444.1 | helix-turn-helix transcriptional regulator | - |
| FOC61_RS11945 (FOC61_11955) | - | 2426274..2426969 (+) | 696 | WP_002454443.1 | helix-turn-helix domain-containing protein | - |
| FOC61_RS11950 (FOC61_11960) | - | 2427000..2427233 (+) | 234 | WP_002454442.1 | hypothetical protein | - |
| FOC61_RS11955 (FOC61_11965) | - | 2427257..2428474 (+) | 1218 | WP_002454441.1 | site-specific integrase | - |
| FOC61_RS11960 (FOC61_11970) | guaA | 2428619..2430160 (-) | 1542 | WP_002454440.1 | glutamine-hydrolyzing GMP synthase | - |
| FOC61_RS11965 (FOC61_11975) | guaB | 2430339..2431805 (-) | 1467 | WP_002454439.1 | IMP dehydrogenase | - |
| FOC61_RS11970 (FOC61_11980) | pbuX | 2431845..2433113 (-) | 1269 | WP_002454438.1 | xanthine permease PbuX | - |
| FOC61_RS11975 (FOC61_11985) | xpt | 2433113..2433691 (-) | 579 | WP_002434618.1 | xanthine phosphoribosyltransferase | - |
| FOC61_RS11980 (FOC61_11990) | - | 2434299..2434706 (+) | 408 | WP_002434071.1 | general stress protein | - |
| FOC61_RS11985 (FOC61_11995) | - | 2434867..2435535 (+) | 669 | WP_002454437.1 | hypothetical protein | - |
| FOC61_RS11990 (FOC61_12000) | - | 2435652..2436506 (+) | 855 | WP_002454436.1 | hypothetical protein | - |
| FOC61_RS11995 (FOC61_12005) | - | 2436768..2438156 (+) | 1389 | WP_002454435.1 | L-cystine transporter | - |
| FOC61_RS12000 (FOC61_12010) | - | 2438215..2438970 (-) | 756 | WP_002454434.1 | NADPH-dependent oxidoreductase | - |
| FOC61_RS12005 (FOC61_12015) | - | 2439142..2439909 (+) | 768 | WP_229716984.1 | 2-keto-4-pentenoate hydratase | - |
| FOC61_RS12010 (FOC61_12020) | ahpC | 2440356..2440925 (+) | 570 | WP_002434612.1 | alkyl hydroperoxide reductase subunit C | - |
| FOC61_RS12015 (FOC61_12025) | ahpF | 2440940..2442463 (+) | 1524 | WP_002454433.1 | alkyl hydroperoxide reductase subunit F | - |
| FOC61_RS12020 (FOC61_12030) | - | 2442784..2443410 (+) | 627 | WP_002454432.1 | NDxxF motif lipoprotein | - |
| FOC61_RS12025 (FOC61_12035) | - | 2443569..2443946 (+) | 378 | WP_002454431.1 | hypothetical protein | - |
| FOC61_RS12030 (FOC61_12040) | - | 2444054..2444632 (-) | 579 | WP_002454430.1 | histidine phosphatase family protein | - |
| FOC61_RS12035 (FOC61_12045) | - | 2444660..2445292 (-) | 633 | WP_002454429.1 | LysE family translocator | - |
| FOC61_RS12040 (FOC61_12050) | - | 2445633..2446487 (-) | 855 | WP_002454428.1 | patatin-like phospholipase family protein | - |
| FOC61_RS12045 (FOC61_12055) | - | 2446650..2446904 (-) | 255 | WP_002434433.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| FOC61_RS12050 (FOC61_12060) | - | 2447207..2447488 (+) | 282 | WP_002454427.1 | hypothetical protein | - |
| FOC61_RS12055 (FOC61_12065) | - | 2447470..2448219 (-) | 750 | WP_002454426.1 | amidohydrolase | - |
| FOC61_RS12060 (FOC61_12070) | - | 2448376..2448633 (+) | 258 | WP_002434565.1 | helix-turn-helix transcriptional regulator | - |
| FOC61_RS12065 (FOC61_12075) | - | 2448704..2449057 (-) | 354 | WP_002454425.1 | membrane protein | - |
| FOC61_RS12550 | - | 2449141..2449371 (-) | 231 | WP_002454424.1 | hypothetical protein | - |
| FOC61_RS12555 | - | 2449374..2449703 (-) | 330 | WP_229716971.1 | hypothetical protein | - |
| FOC61_RS12075 (FOC61_12085) | - | 2449840..2450094 (-) | 255 | WP_002454422.1 | hypothetical protein | - |
| FOC61_RS12080 (FOC61_12090) | rpsR | 2450421..2450663 (-) | 243 | WP_001831354.1 | 30S ribosomal protein S18 | - |
| FOC61_RS12085 (FOC61_12095) | ssbA | 2450710..2451219 (-) | 510 | WP_002434425.1 | single-stranded DNA-binding protein | Machinery gene |
| FOC61_RS12090 (FOC61_12100) | rpsF | 2451241..2451537 (-) | 297 | WP_002434058.1 | 30S ribosomal protein S6 | - |
| FOC61_RS12095 (FOC61_12105) | - | 2451670..2451834 (-) | 165 | Protein_2366 | recombinase family protein | - |
| FOC61_RS12100 (FOC61_12110) | - | 2451950..2452696 (-) | 747 | WP_002454420.1 | HAD family hydrolase | - |
| FOC61_RS12105 (FOC61_12115) | - | 2452700..2453116 (-) | 417 | WP_229716969.1 | NUDIX domain-containing protein | - |
| FOC61_RS12110 (FOC61_12120) | - | 2453113..2454003 (-) | 891 | WP_002454418.1 | DMT family transporter | - |
| FOC61_RS12115 (FOC61_12125) | - | 2454029..2454394 (-) | 366 | WP_002454417.1 | NUDIX domain-containing protein | - |
| FOC61_RS12120 (FOC61_12130) | - | 2454407..2455084 (-) | 678 | WP_002434477.1 | hypothetical protein | - |
| FOC61_RS12125 (FOC61_12135) | - | 2455088..2456227 (-) | 1140 | WP_230455171.1 | aminotransferase class V-fold PLP-dependent enzyme | - |
| FOC61_RS12130 (FOC61_12140) | - | 2456408..2456737 (+) | 330 | WP_002454415.1 | helix-turn-helix domain-containing protein | - |
| FOC61_RS12135 (FOC61_12145) | - | 2456871..2457686 (+) | 816 | WP_002454414.1 | GH25 family lysozyme | - |
Sequence
Protein
Download Length: 169 a.a. Molecular weight: 18688.18 Da Isoelectric Point: 4.5778
>NTDB_id=449497 FOC61_RS12085 WP_002434425.1 2450710..2451219(-) (ssbA) [Staphylococcus capitis strain FDAARGOS_753]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQAENVNNYLSKGSLAGVDGRIQSR
SYENQEGRRIFVTEVVCDSVQFLEPKNSQQGGQRSQNNDFQDYGQGFGGQQSGQNTSYNNNNSSNSNQSDNPFANANGPI
DISDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQAENVNNYLSKGSLAGVDGRIQSR
SYENQEGRRIFVTEVVCDSVQFLEPKNSQQGGQRSQNNDFQDYGQGFGGQQSGQNTSYNNNNSSNSNQSDNPFANANGPI
DISDDDLPF
Nucleotide
Download Length: 510 bp
>NTDB_id=449497 FOC61_RS12085 WP_002434425.1 2450710..2451219(-) (ssbA) [Staphylococcus capitis strain FDAARGOS_753]
ATGTTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCAGAATACAGAACCACTCCCTCAGGCGTAAGTGTAGC
GACATTTACTCTAGCAGTTAATCGTACTTTCACGAATGCTCAAGGGGAACGCGAAGCTGATTTCATTAACTGTGTTGTCT
TTAGAAGACAAGCTGAAAATGTTAATAACTACTTATCTAAAGGTAGTTTAGCTGGCGTTGATGGTCGCATACAATCGCGT
AGTTATGAAAATCAAGAAGGTCGTCGTATTTTTGTTACTGAAGTTGTGTGTGATAGTGTTCAATTCCTTGAACCTAAGAA
TTCACAACAAGGTGGCCAACGTTCACAAAACAACGATTTCCAAGACTATGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAATACGTCTTACAATAACAATAATTCATCAAACTCTAATCAATCAGACAACCCATTTGCAAATGCTAATGGCCCAATC
GATATTAGTGATGATGATTTACCATTCTAA
ATGTTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCAGAATACAGAACCACTCCCTCAGGCGTAAGTGTAGC
GACATTTACTCTAGCAGTTAATCGTACTTTCACGAATGCTCAAGGGGAACGCGAAGCTGATTTCATTAACTGTGTTGTCT
TTAGAAGACAAGCTGAAAATGTTAATAACTACTTATCTAAAGGTAGTTTAGCTGGCGTTGATGGTCGCATACAATCGCGT
AGTTATGAAAATCAAGAAGGTCGTCGTATTTTTGTTACTGAAGTTGTGTGTGATAGTGTTCAATTCCTTGAACCTAAGAA
TTCACAACAAGGTGGCCAACGTTCACAAAACAACGATTTCCAAGACTATGGTCAAGGATTCGGTGGTCAACAATCAGGAC
AAAATACGTCTTACAATAACAATAATTCATCAAACTCTAATCAATCAGACAACCCATTTGCAAATGCTAATGGCCCAATC
GATATTAGTGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
63.483 |
100 |
0.669 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.172 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.143 |
66.272 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.361 |